KEGG   Olsenella uli: Olsu_0493Help
Entry
Olsu_0493         CDS       T01285                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ols  Olsenella uli
Pathway
ols00010  Glycolysis / Gluconeogenesis
ols00030  Pentose phosphate pathway
ols00051  Fructose and mannose metabolism
ols00052  Galactose metabolism
ols00680  Methane metabolism
ols01100  Metabolic pathways
ols01110  Biosynthesis of secondary metabolites
ols01120  Microbial metabolism in diverse environments
ols01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ols00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Olsu_0493
   00030 Pentose phosphate pathway
    Olsu_0493
   00051 Fructose and mannose metabolism
    Olsu_0493
   00052 Galactose metabolism
    Olsu_0493
  Energy metabolism
   00680 Methane metabolism
    Olsu_0493
Enzymes [BR:ols01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Olsu_0493
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Olsu_0493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ADK67608
UniProt: E1QYZ4
Position
complement(542403..543662)
Genome map
AA seq 419 aa AA seqDB search
MYGTPCDTHGTLRNVLVGQSGGPTAAINASLAGVVSAARRQGAHAVGMRYGIEGFLAGRT
VDLDAALPTSVELELLRHTPASWLGSCRYKLPDASEDAGTYERLFSAFERQQVDAVLYIG
GNDSMDTIAKLGAWGSRVGSGVRFVGIPKTIDNDLVGTDHTPGYGSAAKYVATSIGELSC
DSDVYDLKGVTVVEIMGRDAGWLAAAAALATQGGVPAADVILLPEAPLEVDALLGRLEGL
LAEKSSVILAASEGARTPDGRLVAERTNAPGTRRDAFGHLAALSGTSRYLAQLVRERLGV
KARAVEISTLQRCASHCASATDLDEAFALGAAGVEAAERGGSERMCALRRSGDAPYGCSI
ETVDVHAVANRTKPVPTSWITADGMGLTVDFERYARPLIAGEPSLAWEDGLPQRLAPLG
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtacggcaccccttgcgatacgcacggcacccttcgcaacgtcctcgtaggccagtcg
ggcggcccgacggccgccatcaacgccagtctcgccggcgtagtgagtgccgcccgcagg
cagggagcccacgccgtcggcatgcgctacggcatagagggcttcctggccggtcgcacc
gtcgacctggacgctgcgctccccacgagcgtcgagctcgagctgctgcgccacacgcct
gccagctggctgggcagctgccggtacaagctcccggacgcatcggaagacgccggcacc
tacgagaggctcttctcggccttcgagcgccagcaggtcgacgcggtgctctacatcggc
ggcaacgactccatggacaccatcgccaagctcggcgcctggggctcacgcgtcggcagc
ggcgtccgcttcgtcggcatccccaagacgatcgacaacgacctggtcgggacggaccac
accccgggctacggctcggcggccaagtacgtggcgacctccatcggcgagctgtcctgc
gactcggacgtctatgacctcaagggcgtcaccgtggtcgagatcatgggccgcgacgca
ggctggctcgccgcggcggcggcgctcgccacacaaggcggcgtccccgcggccgacgtc
atcctcctgcccgaggcgccgctcgaggtcgacgccctgctcggcaggcttgaggggctc
ctggccgagaagagcagcgtcatcctcgccgcgagcgaaggcgcacgcacgcctgacggg
cgcctcgtagccgagcggaccaacgcgcccgggacccggcgcgacgccttcggccacctg
gcggcgctctcgggcaccagccggtacctggcgcagctcgtgagggagcgcctgggcgtc
aaggcccgtgcggtcgagatctcgaccctgcagcgctgcgccagtcactgcgcaagcgcg
acggatctggacgaggccttcgcgctgggcgcagctggcgtcgaggcggcggagcgcggc
gggagcgagcggatgtgcgccctcaggcgcagcggggacgccccttacggctgctcaatc
gagacggtggacgtccacgccgtcgccaaccggaccaaacccgtccccacgagctggatc
accgcagacggcatggggctcaccgtcgacttcgagcgctacgcgcgaccgctcattgcc
ggcgagccctccctcgcctgggaggacgggctcccccaacgccttgcccctctcgggtaa

DBGET integrated database retrieval system