KEGG   Olsenella uli: Olsu_0533Help
Entry
Olsu_0533         CDS       T01285                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ols  Olsenella uli
Pathway
ols00010  Glycolysis / Gluconeogenesis
ols00052  Galactose metabolism
ols00500  Starch and sucrose metabolism
ols00520  Amino sugar and nucleotide sugar metabolism
ols00521  Streptomycin biosynthesis
ols01100  Metabolic pathways
ols01110  Biosynthesis of secondary metabolites
ols01120  Microbial metabolism in diverse environments
ols01130  Biosynthesis of antibiotics
ols01200  Carbon metabolism
Module
ols_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ols00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Olsu_0533
   00052 Galactose metabolism
    Olsu_0533
   00500 Starch and sucrose metabolism
    Olsu_0533
   00520 Amino sugar and nucleotide sugar metabolism
    Olsu_0533
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Olsu_0533
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Olsu_0533
Enzymes [BR:ols01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Olsu_0533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: ADK67648
UniProt: E1QZ34
Position
591527..592471
Genome map
AA seq 314 aa AA seqDB search
MAHVLGIDIGGTSIKAGLFAEGGRLLDVRQIPTGSLVCAEAFAGVVTGLRELCSVNDVDE
GDVRAVGLDVPGPVDDQGRVGMLPNIELDPDGLQDAIVSHFSGAALAFVNDANAAALGEL
WQGSAKGVGSFVLVTLGTGVGGGVVAGGHLVSGASGAAGEIGHVTVNPEEERTCGCGRKG
CLEQYASATGIVRLYRQELARRGIEGARVRHDTDTLTVFEAARAGDEAAVRAIDSMCDYL
GFALAQISCVIDPEVFLIGGGVAGGFEQFSVRLSSAFRARCLASCASTRILPCSLGNKAG
MYGVAFAALQKAGE
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggcacatgttttgggcatcgacattggcggaacctccatcaaggcaggcctctttgcc
gagggtggcaggctcctggacgtcaggcagatccccacgggctcgctcgtgtgcgcggag
gccttcgccggggtggtcaccgggctgcgcgagctctgctccgtcaacgacgtggacgag
ggggacgtgcgtgccgttggccttgacgtgcctggtcccgtggacgaccagggccgcgtg
ggcatgctccccaacatcgagctcgaccccgacgggctgcaggatgccatcgtcagccac
ttctcgggcgcggccctggccttcgtgaacgacgcgaacgcggcggcgttgggcgagctc
tggcaggggtctgccaagggcgtcggcagcttcgtgctggtgacgctcggcacgggcgtc
ggtggtggtgtggtcgcaggtggccatctcgtctcgggggcgtccggtgccgcgggggag
atcggccacgtcacggtcaaccccgaggaggagcgtacctgcggctgtggtcgcaagggc
tgtctggagcagtacgcgtccgccacgggcatcgtccgtctgtatcggcaggagctcgcg
cgccgcggcatcgagggcgcgcgcgttcggcatgacaccgacaccctcaccgtgttcgag
gcggcgcgcgcaggtgatgaggctgccgtgcgtgcgatcgattccatgtgcgattacctg
gggttcgcgttagcgcagatttcctgcgtcatcgaccccgaggtgttcctcatcggaggc
ggcgtcgcgggcggcttcgagcagttctcagttcgcctctcttcggcatttcgggctcgc
tgcctggcatcctgcgcgtcgaccaggatcctgccgtgctctctgggcaacaaggcgggc
atgtacggcgtcgccttcgcagccctgcagaaggctggcgagtag

DBGET integrated database retrieval system