KEGG   Olsenella uli: Olsu_0600Help
Entry
Olsu_0600         CDS       T01285                                 

Definition
dTDP-4-dehydrorhamnose reductase (EC:1.1.1.133 5.1.3.13)
Orthology
K00067  
dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ols  Olsenella uli
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ols00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Olsu_0600
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Olsu_0600
Enzymes [BR:ols01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.133  dTDP-4-dehydrorhamnose reductase
     Olsu_0600
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Olsu_0600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
670275..671720
Genome map
AA seq 481 aa AA seqDB search
MDFEKDLRSFGTEIAGLRVFDLCVHGDDRGWFKENWQQAKMSSCGLPDFHPVQNNISFNA
QRGVTRGIHAEPWDKYISVASGSIFGVWVDLRAGEGFGRVFSCRIDPSKAVFVPRGVGNA
FQALEDGTVYTYLVNAHWSQELKESYTFVNLADEQLAIEWPIPLSECELSQADRDHPALR
DVSPMQGKRTLVTGCNGQLGRAVRQLANERKLVGFDYCDIDTFDFSDIRSYDDIPWDAYG
AVINCGAYTAVDRAESPEGRVMCWKANALGPSLLTQTCARHGITLVHVSSEYVFDGSREL
HDEDETYAPLSVYGQSKAAGDIALSCCPKYYIVRTSWVIGDGHNFVKTMARLSDRCADPA
DSLDSVSVVNDQLGRPTFADELARGIFWLLDTRPAYGIYNLSNAGRIASWYDIARRTFEM
RNGNGHCVHATSTADYYAGSEAPVACRPRNSALSLEKMCRLGFEPRDWEGQLSSYMRRCE
R
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
gtggactttgaaaaggacctgcgttcctttggtacggagatagccggactcagggtgttt
gacctgtgcgttcatggtgatgacaggggatggttcaaggagaactggcagcaggcaaag
atgtcctcctgcgggcttcctgacttccatcccgtgcagaacaacatcagtttcaatgct
cagaggggagttacgcgtgggattcacgccgagccttgggacaagtacatctcggttgcc
tctgggtcgatttttggggtctgggttgacttgcgtgccggggagggctttgggagggtt
ttcagttgccgcatcgatccctccaaagccgtcttcgttccccgaggtgtgggcaatgcc
ttccaggcgctggaagacgggaccgtgtacacgtatctcgtcaatgcccactggtcccag
gagctcaaggaatcgtacacctttgtgaacctggcggacgagcagcttgcgatagaatgg
cccatccccctttcggagtgtgagctgtcccaggctgacagggaccatcctgcccttcgc
gacgtgtctcccatgcagggaaaaaggacgctcgttacgggctgcaatggacagctcggg
agggctgtgcgccagcttgcgaacgagaggaagctggtgggcttcgactactgtgacatc
gacaccttcgacttctcagacatccggtcatacgacgacatcccctgggatgcgtatgga
gcagttatcaactgcggggcctacactgcggttgaccgtgcggagtcgcccgagggccgt
gtgatgtgctggaaggcaaatgccctcggccccagcctgcttacccagacctgcgccaga
catggcatcacgttggtgcatgtttcgtccgaatatgtgtttgatggcagcagggagctg
catgacgaggacgagacctatgcccccctgtcagtctatggccagtccaaggctgccggt
gatatcgccctgtcctgctgtcccaagtactacatcgtccgcacgagctgggttatcgga
gatggtcacaatttcgtgaagaccatggccaggctctctgaccgatgcgccgatccggca
gactcgcttgattccgtctcggtcgtcaacgaccaacttggtcgtccgacgtttgcggac
gagcttgcacgaggcatcttctggctgctggacacccgtcccgcctacggtatatataac
ctctcgaatgcgggacgcattgctagctggtacgacattgccagacggacatttgagatg
agaaatggcaacgggcactgcgtacatgccacctctacggccgactattatgcggggtct
gaggcccccgtggcttgcaggccgcgcaatagcgccctttcccttgagaagatgtgccgt
ctgggatttgagccacgtgactgggagggacagctctcttcatacatgagacgctgcgag
cggtag

DBGET integrated database retrieval system