KEGG   Olsenella uli: Olsu_0620Help
Entry
Olsu_0620         CDS       T01285                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ols  Olsenella uli
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ols00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Olsu_0620
Enzymes [BR:ols01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Olsu_0620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
693467..694414
Genome map
AA seq 315 aa AA seqDB search
MSGEKNEHKVIVFGSLNMDLSVECSEYPRRGQTVLGRGFVTTPGGKGGNQAVACARMGAD
TFMVGKVGADTFGQQLLVSLTNHGVSVGNVSLTNWAATGTALVVRSGDDNRIVVDPGANQ
RIRYEEVRSAIHGLGQDRNIFLTQLECDFDVTMDALRCANRNYLYTILNAAPAHRLPHDV
YQTLDLLCVNESECELLSGIRPVDDASCAMALGRFADLGVRHTVITLGSRGSVTTERGQL
VRVSAHEIQAVDTTGAGDAYLGELAAHLAFGGSIVDGMRYATAAAALCCTKVGAQDAMPT
WDQVEKFAAAHRVRS
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcgagaagaacgagcacaaggtcatcgtgttcggcagcctcaacatggatctc
tccgtggagtgctcggagtatccccgaaggggccagaccgtcctagggcgcggcttcgtg
accaccccgggtggcaagggcggcaaccaggccgttgcctgcgcacggatgggcgcggac
accttcatggtgggaaaggtgggcgccgatacctttggccagcagcttctggtgtcactc
accaaccatggcgtgtccgtgggcaacgtcagcctcaccaactgggcggcgacgggcacg
gcgctggtcgtgcgctcaggcgatgacaaccgcatcgtcgtcgacccgggggccaaccag
aggatccgctacgaggaggtccgttcggccatccatggcctggggcaggaccgcaacatc
ttcctgacgcagctggagtgcgacttcgacgtcacgatggacgcgctcaggtgcgcaaac
cgcaactacctgtacaccatcctgaacgccgcgcccgcacacaggctcccgcacgacgtc
taccagaccctcgacctgctgtgcgtcaacgagagcgagtgcgagctgctctcgggcatc
cgtccggtggatgacgcctcctgcgccatggcacttggtcgcttcgcggacctgggcgtc
aggcacacggtcatcaccctggggtcacgtgggtcggtaacgacggagaggggccagctc
gtgcgtgtctcggcccacgagatccaggcggttgacacgacaggtgcgggggatgcctac
ctcggcgagctggcggcacacctggcctttggcggttcgatcgtggatggcatgcgctac
gccacggccgccgcggcgctctgctgcaccaaggtgggggcccaggacgccatgcccacc
tgggatcaggtggagaagttcgctgcggctcacagggttcgctcgtga

DBGET integrated database retrieval system