KEGG   Olsenella uli: Olsu_0704Help
Entry
Olsu_0704         CDS       T01285                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ols  Olsenella uli
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ols00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Olsu_0704
Enzymes [BR:ols01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Olsu_0704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
787728..788357
Genome map
AA seq 209 aa AA seqDB search
MIVQLTGTLVEVLPTHVIVDVGGIGYELGVSATTAASLPAVGEAGVTLLARMLVKESAVE
LYGFASREERAVFDRLVGVSGVGPKLALAVLSTFSPASLATVVVTQDATRMATVPGVGKK
KAQRLLMELQDVFTRDTELRGLVGMSEPAPRSPLANTAESVQSDATSALLAMGFTPQEAE
LALRGHEDAGALTVEKAISYALRHLGGGA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtgcagctgacgggaaccctcgtcgaggtgctccccacccatgtgatagtcgac
gtcggtggtatcggctacgagcttggtgtgtcggcaaccacggctgcctcgcttcccgcc
gtaggcgaggccggcgtcaccctccttgcgcgcatgctggtgaaggagagtgcggtcgaa
ctctacggctttgcgtcgcgcgaggagcgagcggtcttcgaccggctcgtcggcgtctcc
ggcgttgggccaaagcttgcgcttgccgtgctctcgaccttctctcccgcctcgctcgca
actgtcgtggtgacccaggacgccacgcgcatggccacggtgcccggcgtcggcaagaag
aaggcccagcgcctcctcatggagctgcaggacgtctttaccagggacacggagctcagg
ggccttgtgggcatgagcgaacctgcgccccggtcccccctcgccaacacggccgagtcc
gttcagagcgacgccacctcggcactgctcgccatgggcttcacgccccaggaggccgag
ctcgccctgaggggccatgaggatgcgggtgccctgacggtcgagaaggcgatctcgtat
gcgctgaggcatctgggaggtggtgcctga

DBGET integrated database retrieval system