KEGG   Olsenella uli: Olsu_0802Help
Entry
Olsu_0802         CDS       T01285                                 

Definition
iron-containing alcohol dehydrogenase (EC:1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ols  Olsenella uli
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ols00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Olsu_0802
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Olsu_0802
   00620 Pyruvate metabolism
    Olsu_0802
   00650 Butanoate metabolism
    Olsu_0802
  Lipid metabolism
   00071 Fatty acid degradation
    Olsu_0802
  Amino acid metabolism
   00350 Tyrosine metabolism
    Olsu_0802
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Olsu_0802
   00626 Naphthalene degradation
    Olsu_0802
Enzymes [BR:ols01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Olsu_0802
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Olsu_0802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
911733..914354
Genome map
AA seq 873 aa AA seqDB search
MAKAEKVIDSVDALTERITAMRAAQAEFATFSQEQVDRIFYAAAMAADKARIPLAKLAVE
ETQMGLVEDKVIKNHYASEYIYNKYKSMRTCGVIEEDKAFGFKKIAEPIGIVAAVIPTTN
PTSTAIFKSLICLKTRNAIIISPHPRAKQCTIEAARVVRDAAEAAGLPKNIISWIDVPSL
ALTNELMHSCDTILATGGPGMVTAAYSSGKPALGVGPGNNPAIIDDSADVELSVNSIIHS
KTFDYGMICATEQNVIVLDKVYDAVKAEFQKRGCYFLKKDEAEKVVNLVIQESGAVNAAM
VGKSASWIAEQAGVSVPRSTKVLIGETSSVDPSNRWAHEKLTTILGMYRAKDFDDAIAKA
SKLIADGGYGHTSSLFCDVNETEKLARHAQAMKTCRILVNTPAAQGGIGDIYNFMMTPSL
TLGCGSWGGNSVCGNVGAANLINIKSVAERRENMLWLRTPEKVYFKKGCMPVALRELSEV
YGKKRCFVVTDQFLYKNGFTKKVEESLDEQGIFHSSFWNVEPDPSLQSALEGLEQMRAFE
PDCIIAMGGGSAMDCGKIMWSLYENPDEKFEDMSADFMDIRKRVYTFPKMGKKAFFVAIP
TSSGTGSEVTPFAIITDKTTGVKWPITDYELMPNMAIVDTDNMMTQPKGLTSASGVDVLT
HCLEAYVSVMASDYTDPMALQGMQLVFDYLPRAYDNPNDIEARDHMANASCLGGLAFANA
FLGMNHSMAHKLGAFHHIPHGWANAVILTRVMRYNSAERPTRMGTFPQYDHPKTLQRYAQ
AARFCGVTGKDDAEVFEKFVAKIGELFDYVGVKHTIAEYGVDEKYFLDSLDAMTEQAFND
QCTGANPRYPLMSEMKELYLDAYYGREASTYED
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggccgagaaagtcattgacagcgtcgacgccctcacggagcgaatcaccgcg
atgcgcgccgcgcaggctgagttcgccacgttcagccaggagcaggttgacaggatcttc
tacgccgcggccatggccgcagacaaggctcgcatccccctcgcgaagcttgccgtcgag
gagacccagatgggcctcgtcgaggacaaggtcatcaagaaccactacgcctccgagtac
atctacaacaagtacaagagcatgaggacctgtggcgtcatcgaggaggacaaggccttc
ggcttcaagaagatagccgagcccatcggcatcgtcgcggccgtcatccccaccaccaac
cccacctcgacggccatcttcaagtcgctcatctgcctgaagacgcgcaacgccatcatc
atcagcccacacccgcgtgccaagcagtgcaccatcgaggccgcgcgcgtcgtgcgcgac
gccgccgaggcggccggcctgcccaagaacatcatcagctggatcgacgtgccctcgctc
gccctcaccaatgagctcatgcactcctgcgacaccatcctcgccaccggcggccccggc
atggtgactgccgcctacagctccggtaagcccgcattgggcgtcggaccgggcaacaat
cccgccatcatcgacgattctgcggacgtcgagctctccgtcaactcgatcatccactcc
aagaccttcgactacggcatgatctgcgccaccgagcagaacgtcatcgtcctggacaag
gtctatgacgccgtcaaggccgagttccagaagcgcggctgctacttcctgaagaaggac
gaggccgagaaggtcgtcaacctggtcatccaggagtcaggcgccgtcaacgccgccatg
gtcggaaagagcgcctcctggatcgccgagcaggccggtgtcagcgtgcccaggtccacg
aaggtcctcatcggcgagacctcgtccgtcgacccctccaaccgttgggctcacgagaag
ctgaccaccatcctgggcatgtaccgtgccaaggacttcgatgacgccattgccaaggca
agcaagctcatcgccgatggcggctacggccacaccagctccctcttctgcgacgtcaac
gagaccgagaagctcgcgcgccacgcccaggccatgaagacctgccgcatcctggtcaac
accccggctgcgcagggcggcatcggcgacatctacaacttcatgatgaccccgtcgctc
accttgggttgtggctcctggggcggtaactccgtctgcggcaacgtgggtgccgccaac
ctcatcaacatcaagagcgtggctgagaggcgtgagaacatgctgtggctccgtacccct
gagaaggtctacttcaagaagggctgcatgcccgtcgccctgcgcgagctctccgaggtc
tacggcaagaagcgctgcttcgtcgtcaccgaccagttcctctacaagaacggttttacc
aagaaggtcgaggagtccctggacgagcaggggatcttccactccagcttctggaacgtc
gagcccgacccctccctgcagtccgccctcgagggcctcgagcagatgagggccttcgag
cccgactgcatcatcgccatgggtggtggctccgccatggactgcggcaagatcatgtgg
tccctctatgagaaccccgacgagaagttcgaggacatgtccgccgacttcatggacatc
cgcaagcgcgtctacaccttccccaagatgggcaagaaggccttcttcgtcgccatcccg
acctcctcgggcactggctccgaggtcacgccgttcgccatcatcacggacaagaccacg
ggggtgaagtggcccatcacggactacgagctcatgcccaacatggccatcgtcgacacc
gacaacatgatgacccagcccaagggcctgacctccgcctccggcgttgacgtcctgacg
cactgcctcgaggcctatgtctcggtcatggcctcggactacaccgatcccatggcactg
cagggcatgcagctcgtcttcgactacctgccccgcgcctacgacaatcccaacgacatc
gaggcccgcgaccacatggccaacgcctcctgccttggcggccttgccttcgccaacgcc
ttcctgggcatgaaccactccatggcccacaagctcggcgccttccatcacatcccccat
ggctgggccaatgccgtcatcctcacgcgcgtcatgcgctacaactctgcggagcggccg
acccgcatgggcaccttcccgcagtacgaccaccccaagacgctgcagcgctatgcgcag
gccgcccgcttctgcggtgtcaccggcaaggacgatgccgaggtgttcgagaagttcgtc
gccaagatcggcgaactctttgactacgtgggcgtcaagcacacgatcgccgagtacggg
gtcgacgagaagtacttcctcgacagcctcgatgcgatgaccgagcaggcattcaacgac
caatgcaccggcgccaacccgcgctaccccctcatgagcgagatgaaggagctctacctc
gatgcctactatggccgcgaggcaagtacctacgaggactag

DBGET integrated database retrieval system