KEGG   Olsenella uli: Olsu_0868Help
Entry
Olsu_0868         CDS       T01285                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ols  Olsenella uli
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ols00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Olsu_0868
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Olsu_0868
Enzymes [BR:ols01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Olsu_0868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
988865..989989
Genome map
AA seq 374 aa AA seqDB search
MGEIFDAPGIIVVKVGSSTLVDAQGSPDRDFIAGLCAQVAQLRGEGHGVAVVSSGAVAAG
MERLGMDVRPLDMPGLQACASAGQAALTEVYADILSAYHIPCGQVLLTRRDLVDRKGYLN
ARNTLGRLLSLGAVPVVNENDTVSVAEFAFGDNDTLGAIVATLINADLYVILSDVDGLYT
ANPQSDPEARLVSRVEAITPEVAAMATGAGSAVGTGGMAAKVRAARAALSAGIPTVICRG
RRAGSLLEAAHGEGVGTRFEPSDGSAPESARKLWIGLAEVPHGTIWLDEGACTAVASRGA
SVLPVGVTRVEGDYAAGDVVNVMAPDGVLVGRGITRYSSEEMVRVHGLKLDVIARFMPEK
DGAVAIHRDELLVF
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagattttcgatgcgcccggcatcatcgtcgtcaaggtcggttcctccaccctg
gtggatgcccagggctctcccgacagggacttcatcgctggcctctgcgcccaggtggcg
cagctgcggggcgaggggcacggcgtcgccgtcgtgtcgtccggtgccgtcgccgctggc
atggaacgtctgggcatggatgtgcggcccctcgacatgccggggctccaggcgtgcgcc
tcggccgggcaggcggctctcacggaggtctacgccgacatcctgagtgcctaccacatc
ccctgcggccaggtcctgctcacccgcagggacctcgtcgatcgcaagggatacctcaac
gcacgcaacactctcggtcggctgctgagcctgggtgccgttccggtcgtgaacgagaac
gacaccgtgtccgtcgccgagtttgccttcggggataacgacaccttgggtgccatcgtg
gcgactctcatcaacgcggacctctacgtcatcctctctgacgtcgacgggctctacacg
gcaaacccccagagcgaccccgaggcgcgcctcgtgtcgcgcgtcgaggccatcacgccc
gaggttgcggccatggcgacgggggcgggttctgccgttgggaccggcggcatggccgcg
aaggtccgtgctgcccgcgcggcactctccgccggcatacccaccgtcatctgtcggggc
cgaagggcagggtccctgcttgaggccgcacacggtgagggcgtgggaacgcgcttcgag
ccctcggacggaagcgcgcccgagagtgcccgcaagctctggatcgggcttgccgaggtt
ccgcatggcacgatatggctcgatgagggggcctgcaccgcggtggcctctcgaggggcc
tccgttctgcccgtgggcgtcacgcgcgtcgagggcgactatgcggccggtgacgttgtg
aacgtcatggcccccgacggcgtgctggtcggtcgtgggatcacgcgctactcaagcgag
gagatggtacgggtccacggcctcaagctcgacgtgatagcccgcttcatgcctgagaag
gacggcgccgtcgccatccaccgtgacgagctcctcgtcttctag

DBGET integrated database retrieval system