KEGG   Olsenella uli: Olsu_0986Help
Entry
Olsu_0986         CDS       T01285                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ols  Olsenella uli
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ols00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1111925..1112518)
Genome map
AA seq 197 aa AA seqDB search
MSRTPRLFVISGPSGAGKGTLVAVVRNQRPGLGLTVSATTRSPRPGEVDGTSYHFLTESD
FADRLARGEFLEWASVHGHRYGTLRSEVDERVAAGRSVILEIDVQGALNVRRVYPDAVLI
FIEPPSMEALEQRLRARGTEDESSLALRLSNARHEMELADKYDARVVNDDLDVAAGELSG
LLEAFETNGGDSYNGSH
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaggactcctcgtctattcgtcatttccggaccgtcaggtgcaggcaagggcacg
ctggttgcggttgttcgcaaccagcgcccgggcttgggcctgacggtttcggctaccacc
aggagtccccgtcctggcgaggtggacggtacctcctaccatttcctcaccgagtcggac
ttcgcagaccgtctcgcgcgcggggagttcctggagtgggccagcgtccatggccaccga
tacgggactctcaggagcgaggttgacgagagggtggccgctggccggtccgtcatcctc
gagattgacgtccagggtgccctgaacgtacgaagggtctatcccgacgcggtgctcatc
ttcatcgagccgccttcgatggaggccctagagcagcgactgcgcgcccgcggcacggaa
gacgagtcctcgctggccctgcgcctttccaacgcacgccacgagatggagcttgccgac
aaatacgacgctcgcgtcgtcaacgatgaccttgacgttgcggcaggcgagctctccggc
cttcttgaagcattcgaaacgaacggaggggactcctacaatggcagtcactga

DBGET integrated database retrieval system