KEGG   Olsenella uli: Olsu_0986Help
Entry
Olsu_0986         CDS       T01285                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ols  Olsenella uli
Pathway
ols00230  Purine metabolism
ols01100  Metabolic pathways
Module
ols_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ols00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Olsu_0986
Enzymes [BR:ols01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Olsu_0986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_33 AAA_29 AAA_30 RsgA_GTPase ABC_tran AAA_22 AAA_23
Motif
Other DBs
NCBI-ProteinID: ADK68097
UniProt: E1QVE4
Position
complement(1111925..1112518)
Genome map
AA seq 197 aa AA seqDB search
MSRTPRLFVISGPSGAGKGTLVAVVRNQRPGLGLTVSATTRSPRPGEVDGTSYHFLTESD
FADRLARGEFLEWASVHGHRYGTLRSEVDERVAAGRSVILEIDVQGALNVRRVYPDAVLI
FIEPPSMEALEQRLRARGTEDESSLALRLSNARHEMELADKYDARVVNDDLDVAAGELSG
LLEAFETNGGDSYNGSH
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaggactcctcgtctattcgtcatttccggaccgtcaggtgcaggcaagggcacg
ctggttgcggttgttcgcaaccagcgcccgggcttgggcctgacggtttcggctaccacc
aggagtccccgtcctggcgaggtggacggtacctcctaccatttcctcaccgagtcggac
ttcgcagaccgtctcgcgcgcggggagttcctggagtgggccagcgtccatggccaccga
tacgggactctcaggagcgaggttgacgagagggtggccgctggccggtccgtcatcctc
gagattgacgtccagggtgccctgaacgtacgaagggtctatcccgacgcggtgctcatc
ttcatcgagccgccttcgatggaggccctagagcagcgactgcgcgcccgcggcacggaa
gacgagtcctcgctggccctgcgcctttccaacgcacgccacgagatggagcttgccgac
aaatacgacgctcgcgtcgtcaacgatgaccttgacgttgcggcaggcgagctctccggc
cttcttgaagcattcgaaacgaacggaggggactcctacaatggcagtcactga

DBGET integrated database retrieval system