KEGG   Olsenella uli: Olsu_0992Help
Entry
Olsu_0992         CDS       T01285                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ols  Olsenella uli
Pathway
ols00240  Pyrimidine metabolism
ols00250  Alanine, aspartate and glutamate metabolism
ols01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ols00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Olsu_0992
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Olsu_0992
Enzymes [BR:ols01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Olsu_0992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ADK68103
UniProt: E1QVF0
Position
complement(1116787..1117722)
Genome map
AA seq 311 aa AA seqDB search
MLSVKHLIDTYSLTADDITQILDTAASFEEVNRRAIKKVPALRGRTIVNLFLEPSTRTKS
SFELAEKRLSADSLSMGGSTSSVVKGESLADTIQTIDAMNVDMFVCRARLAGTPRKITEN
TDAIVINAGDGKHQHPTQAMLDLYTIRKHFGHLAGLKVAIVGDLAHSRVCGSLAPALKTM
GADVTLVGPPTFQVDDPDWFGCPQTSSLDEVIEDMDVVYMLRVQLERMEGAAIPSRREYN
RLYGLDVRRVGRMKDNAIICHPGPMNRGMEINADVADCARSRILDQVNAGVLTRMAEMYL
LLGGENNGISA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgctctctgtcaaacacctcatcgacacctacagcctcacggctgacgacatcacccag
atactcgacaccgccgcatcgttcgaggaggtcaacaggcgcgccatcaagaaggtcccc
gccctgcgcggacgaaccatcgtgaacctcttcctcgagccctccacgcgcaccaagagc
tccttcgagctcgccgagaagcgcctgtccgcagacagcctgagcatgggcggctccacc
tcctcggtcgtcaagggggaatccctcgccgacaccatccagaccatcgacgccatgaac
gtcgacatgttcgtctgccgagcccgccttgccgggaccccgcggaagatcaccgagaac
accgatgccatcgtcataaacgcgggcgacggcaagcaccagcatcccacgcaggccatg
ctcgacctctacaccatccgcaagcacttcggccatcttgcgggcctcaaggtcgccatc
gtcggcgacctcgcgcacagccgcgtctgcggctcccttgcgccggccctcaagaccatg
ggcgccgacgtcaccctggtgggccccccgaccttccaggtggacgaccccgattggttc
ggctgcccgcagacctccagcctcgacgaggtcatcgaggacatggacgtcgtctacatg
ctgcgcgtccaactggagcgcatggagggcgccgccatcccgtcccgtcgcgagtacaat
cgcctctacggccttgacgtgaggcgcgtgggcaggatgaaggacaacgccatcatctgc
cacccgggtcccatgaaccggggcatggagatcaacgccgacgttgccgactgcgcgcgc
tcgaggatccttgaccaggtcaatgctggcgttctcacccgcatggccgagatgtacctg
cttctgggaggagagaacaatggcatttctgcttaa

DBGET integrated database retrieval system