KEGG   Olsenella uli: Olsu_1245Help
Entry
Olsu_1245         CDS       T01285                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ols  Olsenella uli
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ols00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Olsu_1245
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Olsu_1245
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Olsu_1245
Enzymes [BR:ols01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Olsu_1245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1414295..1415011)
Genome map
AA seq 238 aa AA seqDB search
MKLILYLSNGYPTIESSIEMARTYVDAGCDMIEMDFPSKDPFLEGDFIARRMAKALEAEC
DYDKYMVGMAKAHALLPDTKFILMAYESTILEIGIGRFGGFCRENDFEDIILVGSSTDEV
KDRLIAAGLKVSCYVQFNLPEEEVRRALESNGFTYLQAVPAPGQATREHPTLKSCIGYLR
SRGLENAIYCGVGVHSPQDAQMVRDAGGDGIFVGSTILRLHDDKLALADKIREFKERC
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcatcctctacctttcaaacggctatccgaccatcgagagcagcatagagatg
gcaaggacctacgtcgatgccggctgcgacatgatcgagatggactttccaagcaaggac
cccttcttggaaggcgacttcatcgcaaggagaatggcaaaggcccttgaggccgaatgt
gattacgacaagtacatggtgggcatggcaaaggcacacgctctgctgccagataccaag
ttcatcctcatggcatacgagagcaccatcctggaaattggcataggcaggtttgggggc
ttctgtagggagaacgacttcgaggacatcatccttgtggggtcaagcacggacgaggtc
aaggatcgcctcatcgccgccggcctgaaggtgagctgctacgttcagttcaacctgccg
gaagaagaggtcagacgagcgctggagtccaacgggttcacctatctgcaggcggtccct
gcacctggacaagccaccagggagcatcccacgctcaagtcctgcatcggctacctcagg
tcacgcgggctagagaatgccatctactgcggtgtgggagtccactccccgcaggacgca
cagatggtcagggatgccggtggggatgggatcttcgtgggctccaccatcctcaggctg
cacgacgacaagctggctcttgcggacaagatacgcgagttcaaggagaggtgctag

DBGET integrated database retrieval system