KEGG   Olsenella uli: Olsu_1268Help
Entry
Olsu_1268         CDS       T01285                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ols  Olsenella uli
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ols00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Olsu_1268
   01230 Biosynthesis of amino acids
    Olsu_1268
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Olsu_1268
   00051 Fructose and mannose metabolism
    Olsu_1268
   00562 Inositol phosphate metabolism
    Olsu_1268
Enzymes [BR:ols01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Olsu_1268
Exosome [BR:ols04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Olsu_1268
  Exosomal proteins of bladder cancer cells
   Olsu_1268
  Exosomal proteins of melanoma cells
   Olsu_1268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1442637..1443401)
Genome map
AA seq 254 aa AA seqDB search
MRNRMIAGNWKMNKTFTEGVVLAQGLVRELEGGTGDVDVVVCPPTVDLKGVSEVIEQEGA
PFSLGAQNVYFEESGAYTGETAPDMLVGIGATHCIIGHSERRGYFGETDEDVNRKAKALM
SHGIVPISCCGESLEVREAGTHVSFVVEQIKKDTAGLKIDDPSKYVIAYEPIWAIGTGKT
ATADDAQEVCGAIRETLAEAFGQEVADGIRILYGGSAKPENVAGFLGKDDVDGALVGGAS
LKADSFAAMVKAAM
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaacaggatgatcgctggcaactggaagatgaacaagaccttcaccgagggcgtc
gtcctcgcacagggcctcgtcagagagctcgagggcggcaccggcgacgtggacgtcgtc
gtctgcccgccgacggtcgacctcaagggagtctcggaggtcatcgagcaggagggcgcg
cccttctccctgggcgcccagaacgtctacttcgaggagagcggggcctacacgggcgag
accgctcccgacatgctggtgggcatcggcgcgacccactgcatcatcggccactccgag
cgtcgcggctacttcggagagaccgacgaggacgtcaacaggaaggccaaggccctcatg
tcgcacggcatcgtgcccatcagctgctgcggcgagtccctcgaggtccgcgaggccggc
acccatgtctcattcgtcgtcgagcagatcaagaaggacaccgcgggcctcaagatcgac
gacccctccaagtacgtcatcgcctacgagcccatctgggccatcggcacgggcaagacc
gccacggccgacgacgcccaggaggtctgcggcgccatccgcgagaccctggccgaggcc
ttcgggcaagaggtcgccgacggcatccgcatcctctacggcggctccgccaagcccgag
aacgtcgcgggcttcctcgggaaggacgacgtcgacggcgccctcgtcggcggcgcctcc
ctcaaggcggactcgttcgccgcgatggtgaaggcggctatgtga

DBGET integrated database retrieval system