KEGG   Olsenella uli: Olsu_1268Help
Entry
Olsu_1268         CDS       T01285                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ols  Olsenella uli
Pathway
ols00010  Glycolysis / Gluconeogenesis
ols00051  Fructose and mannose metabolism
ols00562  Inositol phosphate metabolism
ols01100  Metabolic pathways
ols01110  Biosynthesis of secondary metabolites
ols01120  Microbial metabolism in diverse environments
ols01130  Biosynthesis of antibiotics
ols01200  Carbon metabolism
ols01230  Biosynthesis of amino acids
Module
ols_M00002  Glycolysis, core module involving three-carbon compounds
ols_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ols00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Olsu_1268
   00051 Fructose and mannose metabolism
    Olsu_1268
   00562 Inositol phosphate metabolism
    Olsu_1268
Enzymes [BR:ols01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Olsu_1268
Exosome [BR:ols04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Olsu_1268
  Exosomal proteins of bladder cancer cells
   Olsu_1268
  Exosomal proteins of melanoma cells
   Olsu_1268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DrsE
Motif
Other DBs
NCBI-ProteinID: ADK68374
UniProt: E1QW71
Position
complement(1442637..1443401)
Genome map
AA seq 254 aa AA seqDB search
MRNRMIAGNWKMNKTFTEGVVLAQGLVRELEGGTGDVDVVVCPPTVDLKGVSEVIEQEGA
PFSLGAQNVYFEESGAYTGETAPDMLVGIGATHCIIGHSERRGYFGETDEDVNRKAKALM
SHGIVPISCCGESLEVREAGTHVSFVVEQIKKDTAGLKIDDPSKYVIAYEPIWAIGTGKT
ATADDAQEVCGAIRETLAEAFGQEVADGIRILYGGSAKPENVAGFLGKDDVDGALVGGAS
LKADSFAAMVKAAM
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaacaggatgatcgctggcaactggaagatgaacaagaccttcaccgagggcgtc
gtcctcgcacagggcctcgtcagagagctcgagggcggcaccggcgacgtggacgtcgtc
gtctgcccgccgacggtcgacctcaagggagtctcggaggtcatcgagcaggagggcgcg
cccttctccctgggcgcccagaacgtctacttcgaggagagcggggcctacacgggcgag
accgctcccgacatgctggtgggcatcggcgcgacccactgcatcatcggccactccgag
cgtcgcggctacttcggagagaccgacgaggacgtcaacaggaaggccaaggccctcatg
tcgcacggcatcgtgcccatcagctgctgcggcgagtccctcgaggtccgcgaggccggc
acccatgtctcattcgtcgtcgagcagatcaagaaggacaccgcgggcctcaagatcgac
gacccctccaagtacgtcatcgcctacgagcccatctgggccatcggcacgggcaagacc
gccacggccgacgacgcccaggaggtctgcggcgccatccgcgagaccctggccgaggcc
ttcgggcaagaggtcgccgacggcatccgcatcctctacggcggctccgccaagcccgag
aacgtcgcgggcttcctcgggaaggacgacgtcgacggcgccctcgtcggcggcgcctcc
ctcaaggcggactcgttcgccgcgatggtgaaggcggctatgtga

DBGET integrated database retrieval system