KEGG   Olsenella uli: Olsu_1549Help
Entry
Olsu_1549         CDS       T01285                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
ols  Olsenella uli
Pathway
ols00010  Glycolysis / Gluconeogenesis
ols00052  Galactose metabolism
ols01100  Metabolic pathways
ols01110  Biosynthesis of secondary metabolites
ols01120  Microbial metabolism in diverse environments
ols01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ols00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Olsu_1549
   00052 Galactose metabolism
    Olsu_1549
Enzymes [BR:ols01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Olsu_1549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADK68648
UniProt: E1QWZ5
Position
1776856..1777881
Genome map
AA seq 341 aa AA seqDB search
MPLETHAFGTLADGREARLIELHNGNGMSVGVTDLGASLVSVRVPDRRGGRPDVTLGFDG
AYGYQDNPWCFGTTVGRCANRIAGATFELAGTTYRLAANEGANNLHSGPHAYGERLWKVI
EAKGSSVSLNLLSRPGDQGFPGALDVTVTYALDEGDRLRISYEALPSEATIVNLTCHAYW
NLNGQASGSVLAHGLTIAADAYTPTDGQGIPTGEVAGLGKTPHDFRTGKQVGADIWRVPN
GYDVNFVLRDGEAHESAATLVGERSGIAMDVTTSAPGLQLFVPGGLDCRGKDGARYQAFD
AVALETQFFPDAIHHKGFPQPVFTPEHPFRSWTEFAFRTVG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgccgcttgagacccacgcctttggaaccctggccgacggccgcgaggcacggctcata
gagctgcacaacggcaacggcatgagcgtcggggtcactgacctgggcgccagcctggtg
agcgtacgggtgccagacaggcgcggcggacgccccgacgtcacgctcggcttcgacggc
gcctacggctaccaggacaacccctggtgctttggcacgaccgtgggtcgctgcgccaac
cgcatcgcaggggcaacgttcgagcttgcgggcaccacgtaccgcctcgcggcgaacgag
ggggccaacaacctgcacagcggaccacacgcctacggcgagcgcctgtggaaggtcatc
gaggcaaagggctcctccgtctcgctcaacctgctgagccgtcccggggaccagggattt
cccggggccctggacgtcacggtgacctatgcgctggacgagggcgaccgcctgcgcatc
tcctacgaggccctccccagcgaggcgaccatcgtcaacctgacctgccacgcctactgg
aacctcaacggccaggcatcgggcagcgtccttgcccatgggctcacgatcgcggcggat
gcctacaccccgacggacgggcagggcatccccacgggcgaggtggcgggcctgggcaag
acgccccacgacttccgcacgggaaagcaggtcggtgctgacatctggcgcgtccccaac
ggttacgacgtcaacttcgtcctcagggacggcgaggcgcacgagagtgccgcgacactg
gtgggcgagcgctcgggcatcgcgatggacgtgacgacaagcgcgcccggcctgcagctg
ttcgtccccggcgggctggactgccgcggcaaggacggcgcacgctaccaggccttcgac
gccgtggccctcgagacgcagttcttccccgacgccatccaccacaagggcttcccccag
cccgtcttcacccccgagcatcccttccgcagctggaccgagttcgccttcaggaccgtc
ggctag

DBGET integrated database retrieval system