KEGG   Olsenella uli: Olsu_1645Help
Entry
Olsu_1645         CDS       T01285                                 

Definition
Histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ols  Olsenella uli
Brite
Enzymes [BR:ols01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Olsu_1645
Transfer RNA biogenesis [BR:ols03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Olsu_1645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1881235..1883157
Genome map
AA seq 640 aa AA seqDB search
MEDFLLDILDHLRSLPPERAGDALAPLELDAIWRRHNRGAREGDRRLSKRFILPFYQRTK
QRDPIRWTSWNVDATLEERLVRTIRMKPRRTASGVATITVITRPQACSSDCLYCPCDLRM
PKSYLAGEPACQRAEHNFFDPYLQVASRLRALSQMGHSVDKVELIILGGTWSDYPRAYQI
WFVRELFRALNDWPIADEALRRRYGSYRELGLTNDATRLAAFVAPQQALVDRGEKSYNDA
LRDLYRESRPHRAAAKRMGATLDGLATEQLRNECASHRVVGLAIETRPDLITPASLTLFR
QLGCTKIQMGIQSTRQETLDANGRRTSIEQVRRSFSLIRLFGFKIHAHLMVNLLGSTPES
DKEDFRTFVSDPGFLPDEIKLYPCALVAGTRLVRLFERGAWRPYDREELVDVLASDVLAT
PPYVRISRMIRDISAGDILVGNKHTNLRQMVEGQIRRDGTAKGVREVRFREISLDAVDLG
SLALDDVTYQTAVTDEHFLQWVTPEGRIAGFCRLSLPHWRELAASDATAAAGGATSVERD
EADVDGGADVQAEVRASELPVEPGEAMIREVHVYGQAARLGKADAAAQHQGLGRALVERA
CGIARSAGYTHVNVISSVGTRAYYRRLGFTDVGLYQRRGL
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggaagacttcctgctggacatactcgatcacctgcgctcgctgccaccggagcgggcg
ggcgatgccttggccccgctggagctggacgccatctggcgccggcacaaccgtggcgcg
cgcgaaggtgacaggcgcctctccaagcgcttcatcctgcccttctaccagcgaacaaag
cagcgggaccccatacgctggaccagctggaacgtcgacgccacgctggaggagcgcctg
gtgcgcaccattcgcatgaagccgcgccgcacggcctcgggcgtggccaccatcacggtc
atcaccaggccgcaggcctgctccagcgactgcctgtactgtccctgcgacctgcgcatg
cccaagagctacctggcaggggagcctgcctgccagcgtgcggagcacaacttcttcgac
ccctacctgcaggtggcctcacgcctgcgcgccctctcgcagatgggccactccgtcgac
aaggtcgagctcatcatcctgggtggcacttggagcgactacccgcgcgcctaccagatc
tggttcgtgcgcgagctgttccgtgcgctcaacgactggcccattgcggacgaggcgcta
cgccgacgttacggcagctaccgagagctggggctcacgaacgacgccacacggctggca
gccttcgtcgcacctcagcaggccctggtcgaccggggcgagaagagctacaacgacgcg
ctgcgcgacctctaccgggaaagccgcccccaccgggctgcggccaagcgcatgggcgcg
accctggacgggcttgcgacggagcagctgcgcaacgagtgcgcttcccaccgcgtcgtg
ggcctggcgatagagacgcgcccggacctgataacgcctgcatcactcacgctgtttcgg
cagttgggctgcaccaagatccagatgggcatccagtccacccgccaggagaccctggac
gccaacggacgccggacaagcatcgaacaggtcaggcggtccttctcgctcattcgcctc
tttggcttcaagatacacgcccacctgatggtgaacctgctgggctccacaccggagtcc
gacaaggaggacttccgcaccttcgtgagcgaccccggcttccttcccgacgagatcaag
ctctatccctgcgcgctggtcgcaggcacgaggctggtccgtctcttcgagcggggcgca
tggcgcccctacgaccgagaggagcttgtcgacgtgctcgcgagcgatgtgctggccacg
ccaccgtacgtccgcatctcgcgcatgatccgcgacatcagcgcgggagacatactggtg
ggcaacaagcacaccaacctgcgccagatggtcgagggtcagatccggcgcgacgggacg
gcgaagggcgtacgcgaggttcgcttcagggagatctcgctggacgccgtcgacctgggc
tccctggccctggacgacgtcacgtaccagaccgccgtcacggacgagcacttcctgcag
tgggtcacgcccgaggggcgcatcgcgggcttttgtcggctgtcgctgccacattggagg
gagcttgctgcgagcgacgcgaccgcagcggcaggcggcgcaacgtcggtcgagagggac
gaggccgatgttgatgggggtgccgacgtgcaggccgaagtgcgggccagcgagctgcca
gtcgagcccggcgaggccatgatccgcgaggtccacgtatacggccaggccgcccgcctg
ggaaaggcggatgctgcggcccagcaccaggggttgggccgcgcgctcgtggaacgcgcc
tgcggcatcgcccgcagcgcggggtacacacacgtcaacgtcatcagctccgtgggcacg
cgcgcgtactaccggcgtctggggtttacggacgtggggctgtaccagcgcaggggtcta
tag

DBGET integrated database retrieval system