KEGG   Olsenella uli: Olsu_1710Help
Entry
Olsu_1710         CDS       T01285                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ols  Olsenella uli
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ols00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Olsu_1710
Enzymes [BR:ols01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Olsu_1710
Exosome [BR:ols04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Olsu_1710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1959803..1961902)
Genome map
AA seq 699 aa AA seqDB search
MDIRSSADLALTSDDLFLLAKGEWYRSYEKLGAHPATSDGVAGYQFAVWAPDVRSVRVIG
DFNDWDIEKNYLSCSENGGVWSGFVAGVSAGDLYKYVVETRYGDLLYKADPYAFYAECPP
GTASRTTDLSGYAWKDAGYLAKRAKRDMMKSPLNIFEVHLGSWRRHDDGLAGNGDPDSDD
HAGSYLTYDELSDELVGYVRRMGYSHIEVLPVMEHPFDGSWGYQVTGYFAPTSRYGEAKQ
FKHFVDACHQAGIGVILDWVPGGFCRDEHGLVHFNGDKLYEKEEHPNWGTFKFDLDRGEV
RSFLISNLLYWVGEYHADGIRMDGVTSMLYLNFGVDDPRQKKFNDKGTEEDFASIRFIQQ
CNDTIGKYYPDVMMIAEESTAWPLVTYPPQDGGLGFHLKWDMGWMNDTLHYMQTDFPWRP
GNHKLLTFSAMYQFNENFVLPLSHDEVVHGKCSLITRQPGDNWRQFAGMRTLALYQMSHA
GAKLNFMGNEIAQFIEWRYYEGIQYFLADQYETHAHQQTFVAALNHFYNEHPALWQRAYT
PDGFEWIDADNSEQSVISFVRHGDDPADDVVILINFDVNPREQFRVGLPKPGYWVESLNS
DDLRYGGSGVTNEGVRFKSEEEPWNLRDQSIELRLPPLAGLILTYAGPLPKKKAPARKGS
TKRGSVAKGAAPAKAPAKTPHKKAPAKARGRKAPSKASR
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atggacatccgttcctctgcggatctggcccttaccagcgacgacctcttcttgcttgcg
aagggcgagtggtatcgcagctacgagaagctgggcgcgcacccggccacgtcggatggc
gtcgcaggctaccagtttgccgtgtgggcgccggacgtcaggagcgtgcgtgtcatcggc
gacttcaacgactgggacatcgagaagaattacctttcctgctccgagaacggtggcgtc
tggtcgggcttcgtcgcgggcgtgagcgcgggtgacctgtacaagtacgtggtggagacc
aggtatggtgacctcctgtacaaggccgacccctacgcgttctacgcggagtgccccccg
gggacggcatcgcgcacgaccgacctctcgggctacgcgtggaaagacgcgggctacctg
gccaagcgtgccaagcgcgacatgatgaagtccccgctcaacatcttcgaggtgcatctg
ggcagctggaggcgtcacgatgacggcctggccggcaacggtgacccagacagcgatgac
cacgccggcagctacctgacttacgacgagctctcggacgagctggtgggctacgtcagg
cgcatgggctactcgcacatagaggtcctgcccgtgatggagcaccccttcgacggctct
tggggctaccaggtcacgggctactttgcccccacctcccgctatggcgaggccaagcag
ttcaagcacttcgtcgacgcctgccaccaggcgggtatcggggtcatcctggactgggtc
ccgggcggcttctgccgcgacgagcacggcctggtccacttcaacggtgacaagctgtac
gagaaggaggagcatcccaactggggcaccttcaagttcgacttggaccgcggggaggtg
cgcagcttcctcatctcgaacctgctctactgggtgggcgagtaccatgccgatggcatc
cgcatggacggcgtcaccagcatgctgtacctgaacttcggggtggacgacccacggcag
aagaagttcaacgacaagggcaccgaggaggacttcgcctccatccgcttcatccaacag
tgcaacgacacgatcggcaagtactatccggacgtgatgatgatcgccgaggagtccacg
gcctggccgctcgtcacctatcctccccaggatggcggcctcggcttccacctcaagtgg
gacatgggctggatgaacgacaccctgcactacatgcagaccgacttcccctggcgtccg
ggcaaccacaagctgctgaccttctcggccatgtaccagttcaacgagaacttcgtgctg
ccgctcagccatgacgaggtggtgcacggcaagtgctcgctcatcacccgccagccgggc
gacaactggcgccagttcgcgggcatgaggacgctggccctctaccagatgtcgcacgcg
ggcgccaagcttaacttcatgggcaacgagatcgcccagttcatcgaatggcgctactac
gagggcatccagtatttcctcgcggaccagtacgagacccacgcccaccagcagacgttc
gtcgctgcgctcaaccacttctacaacgagcaccccgccctttggcagcgggcctacacg
cccgatggcttcgagtggatagatgcggacaacagcgagcagtcggtcatatcgttcgtg
cgtcacggcgacgatcccgcggacgacgtggtcatcctcatcaacttcgacgtcaacccg
cgcgagcagttccgcgtcggcctgcccaagccgggatattgggtcgagagcctcaactcg
gacgacctcaggtacggcggctcgggcgtcaccaacgagggcgtcaggttcaagagcgag
gaggagccctggaacctgcgcgaccagtccatcgagctgcgtctgccgcctctggcaggc
ctgatcctgacctatgcgggcccccttcccaagaagaaggcccctgccaggaaggggagc
acgaagaggggctcggtggcgaagggcgctgccccggcgaaggcccccgccaagacgccc
cacaagaaggcccccgccaaggcgcggggccgcaaggcacccagcaaggcatccaggtag

DBGET integrated database retrieval system