KEGG   Olsenella uli: Olsu_1718Help
Entry
Olsu_1718         CDS       T01285                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ols  Olsenella uli
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ols03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1969083..1969706)
Genome map
AA seq 207 aa AA seqDB search
MDARTPDGTTSDGRALQRLLDELGRLPGIGPKSAQRIAYWLLEADVEAARRLSGAIMQVK
QQVHFCPVCFSYATRDTCDVCADLSRDRGTICVVSEPRDVSAIERTGAYHGLYHVLGGVI
SPMDKIGPDQLHVKELLQRLADESVKEVILATNPDVEGETTATYLSRVIRPLGVAVSRLA
SGLPVGGDLEYADEVTLGRAIEARRTI
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggacgcccgcacgccggatggcacgacaagcgacggcagggctctgcagcgcctgctc
gacgagctgggcaggttgccgggcatcggccccaagtcggcacagcgcatagcctattgg
ctgctcgaggcggacgtcgaggcggcccgtaggctgagtggggccatcatgcaggtcaag
cagcaggtccacttctgcccggtgtgcttctcgtatgccacgcgcgacacctgtgacgtc
tgtgcggacctctcgcgcgaccgggggaccatctgcgtggtgtcggagccccgtgacgtt
tccgcaatcgagcgtacgggcgcctaccacgggctctatcatgtgcttgggggagtgatc
tcgcccatggacaagatcgggcccgaccagctgcatgtcaaggagctgctccagcgcctt
gccgacgaatcggtcaaggaggtcatcctggccaccaaccccgacgtcgagggcgagacc
acggcgacctacctctcccgcgtcatccgtccgttgggcgttgcggtgtcgcgtcttgcg
agtggcctgcccgtggggggggacctcgagtacgcggacgaggtgaccctggggagggcc
atcgaggcacgtaggacaatctag

DBGET integrated database retrieval system