KEGG   Ostreococcus lucimarinus: OSTLU_10425Help
Entry
OSTLU_10425       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
olu  Ostreococcus lucimarinus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    OSTLU_10425
Enzymes [BR:olu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     OSTLU_10425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 196 aa AA seqDB search
LEGCVREILRALGEDVEREGLLDTPSRVAKALMFATRGYDACATVALGTALFHETGMANA
MRTTTTNEIANGTHDMVLVRDIPVFSTCAETFMPFYGVIHVGYAPNAGVIVGLSKLARVA
EVYARRLQTPDGLQVQERLTRDVAEEVSKLTGGLGVMVAARAAHLCMVSRGVEKPGSSTC
TVTKLGRFASEPALRS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
ttggaggggtgcgtgcgagagattttgcgggctttaggagaagacgtcgagcgagaggga
ttattagacaccccctcgcgcgtggccaaggcgttgatgttcgcgacgcgcggttacgac
gcgtgcgcgacggtggcgctagggacggcgctgtttcacgagacgggcatggcgaacgcg
atgcgaacgacgacgacgaatgagatcgcgaatggcacgcacgatatggtgctcgtgagg
gatattccagtgttcagcacgtgcgcggagacattcatgccgttctacggggtgattcac
gtcgggtacgccccgaacgcgggcgtcatcgttggcttgagcaagctcgcgcgcgtcgcg
gaggtgtacgcgagacgattacaaaccccagatgggctgcaagtgcaagagcgactcacg
cgcgatgtcgcagaagaagttagcaaacttacgggaggattaggggtcatggtggccgcg
cgcgcggcgcatctttgcatggtgagtcgaggtgtggaaaagccggggagttcgacgtgc
acagtgacgaaactcggtcgttttgcctccgagcccgcgctgcgctcg

DBGET integrated database retrieval system