KEGG   Ostreococcus lucimarinus: OSTLU_10513Help
Entry
OSTLU_10513       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
olu  Ostreococcus lucimarinus
Brite
Protein phosphatases and associated proteins [BR:olu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     OSTLU_10513
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 131 aa AA seqDB search
LKAIYKAFLESDKDGSGRVDVNEFVRMLRVDRTPFVERLFSMFDTDRTGLIDVKEFIVGM
ANVGGEARDNKIQFAFSVYDLDGSGYIDSSELRKIICATNMSTDKQIERKVEWLMRQCDT
DGDGNISFEEF
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
ttaaaagcaatatacaaggcgttcttggagagcgataaggatgggagcgggcgcgtggac
gtgaatgaattcgtgcgcatgttgcgcgtcgatcgcacgccgtttgtcgagcgtctgttt
tccatgtttgacaccgatcgcaccggtctcatcgacgttaaggaattcatcgtcggtatg
gccaacgtcggtggcgaggcacgcgataataagattcagttcgcgttcagcgtgtacgat
ctcgacggttcggggtacatcgactcgagcgaactgcgcaaaatcatttgcgcgacgaat
atgagcaccgacaagcaaatcgaacgcaaggtagaatggctcatgcgtcagtgcgatacc
gacggcgatgggaacatatcgttcgaagagttc

DBGET integrated database retrieval system