KEGG   Ostreococcus lucimarinus: OSTLU_10646Help
Entry
OSTLU_10646       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K09584  protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:olu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    OSTLU_10646
Enzymes [BR:olu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     OSTLU_10646
Chaperones and folding catalysts [BR:olu03110]
 Protein folding catalysts
  Protein disulfide isomerase
   OSTLU_10646
Membrane trafficking [BR:olu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    OSTLU_10646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_2 AhpC-TSA OST3_OST6 Thioredoxin_8 Thioredoxin_7 Lectin_leg-like Thioredoxin_3
Motif
Other DBs
NCBI-GeneID: 5001222
NCBI-ProteinID: XP_001417532
JGI: 10646
UniProt: A4RW74
Position
4:complement(join(<539352..539592,539812..539888))
Genome map
AA seq 106 aa AA seqDB search
MDLTTENFDSQVGGGKGAFIKFYAPWCGHCKALAPAWKQLGEAFADNEGVVIGDVDCTKQ
ESLCQKYGVQGYPTLKYFTGATSATGDAYQGGRDFEALQTWASENL
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggatctcactaccgaaaactttgattcccaagtcggtggcggaaaaggcgctttcatc
aagttctacgctccctggtgtggtcactgcaaggcgcttgcgccggcgtggaagcaactt
ggtgaggctttcgccgataacgaaggcgtcgtcatcggcgacgtcgactgcaccaagcag
gaatccctctgccaaaagtacggcgtgcaaggttacccgacgctcaagtacttcaccggt
gccacgtcggcgactggtgacgcgtaccaaggcggccgcgactttgaggcgctccaaacg
tgggcgagcgagaacctc

DBGET integrated database retrieval system