KEGG   Ostreococcus lucimarinus: OSTLU_10646Help
Entry
OSTLU_10646       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
olu  Ostreococcus lucimarinus
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:olu04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 106 aa AA seqDB search
MDLTTENFDSQVGGGKGAFIKFYAPWCGHCKALAPAWKQLGEAFADNEGVVIGDVDCTKQ
ESLCQKYGVQGYPTLKYFTGATSATGDAYQGGRDFEALQTWASENL
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggatctcactaccgaaaactttgattcccaagtcggtggcggaaaaggcgctttcatc
aagttctacgctccctggtgtggtcactgcaaggcgcttgcgccggcgtggaagcaactt
ggtgaggctttcgccgataacgaaggcgtcgtcatcggcgacgtcgactgcaccaagcag
gaatccctctgccaaaagtacggcgtgcaaggttacccgacgctcaagtacttcaccggt
gccacgtcggcgactggtgacgcgtaccaaggcggccgcgactttgaggcgctccaaacg
tgggcgagcgagaacctc

DBGET integrated database retrieval system