KEGG   Ostreococcus lucimarinus: OSTLU_119464Help
Entry
OSTLU_119464      CDS       T01029                                 

Gene name
DlsT
Definition
2-oxoglutarate dehydrogenase E2 subunit-like protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
olu  Ostreococcus lucimarinus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OSTLU_119464 (DlsT)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OSTLU_119464 (DlsT)
  Amino acid metabolism
   00310 Lysine degradation
    OSTLU_119464 (DlsT)
Enzymes [BR:olu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     OSTLU_119464 (DlsT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 509 aa AA seqDB search
MGRATTGTTRDGANETETANATTRARARAMIGDGGFDAMTMIRRHKGGTATREETIAVPS
MGDSISEGAVASVTKAVGDEVATDETVAQIETDKVTIDVRAPSGGTVTRVDAKVGDTVNV
GQAVMAFAPGVGGKKGGKGGAAAPKAEAASGAPVSVEVPSMGDSITEGSVAALLVKPGQK
VAMDEVIAQIETDKVTIDVRASTSGTVTDVLAKEGDTVSVGQKVATLAPGAGPEKQASAA
PAAAAMAAATPAKEAPKATAAPSPAPAAPKVTSGARAETRVPMSRLRLRVAERLKSSQNT
YAMLTTFNEIDMTNVMQMRAEYKDAFLEKHGVKLGFMSTFVKAAAKALQEEPSVNAIIDG
DEIVYRNYVDISVAVSAPKGLVVPVLRSCEGMNFADVESSIASYGKKARDGTLSIDEMAG
GTFTISNGGVFGSLTGTPIINPPQSAILGMHSIVWRPVCVGADRAIVARPMMNVALTYDH
RLVDGREAVTFLKSIKESVEDPRRMMLEV
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggacgcgcgacgacgggaacgacgcgcgacggcgcgaacgagacggagacggcgaac
gcgacgacgagggcgcgcgcgcgcgcgatgatcggcgacggaggattcgacgcgatgacg
atgattcgaaggcacaagggcgggacggcgacgcgagaggagacgatcgcggtgccgtcg
atgggggattcgatctcggagggcgcggtggcgagcgtgacgaaggcggtcggggacgag
gtggcgacggatgagacggtggcgcaaatcgagacggacaaggtgacgatcgacgtgcgg
gcgccgagcggggggacggtgacgcgcgtggacgcgaaggtgggggatacggtgaacgtg
gggcaagcggtgatggcgttcgcgccgggcgtcggcgggaaaaagggggggaagggcggc
gcggcggcgcccaaggcggaggcggcgagcggcgcgccggtgagcgttgaggtgccttcg
atgggcgactccatcacggaggggagcgtcgcggctttgctcgtgaaaccgggtcaaaag
gtggcgatggacgaagtgatcgcgcaaattgaaacggataaagtcaccatagacgttcgc
gcgtcgacgagcgggacggtgacggacgtgctcgcgaaggagggcgacaccgtctccgtc
ggtcaaaaggtggcgacgctcgctccgggggcggggccggagaaacaagcttcggccgcg
ccagcggccgcggcgatggccgcggcgacgccggccaaggaagcgccgaaagcgaccgct
gcgccatcgcccgcgccggcggcgccgaaagtcacgtcgggcgctcgcgccgagacgcgc
gtgcccatgtcgcgcttgcgcttgcgcgtcgcggagcggttgaagagctcgcaaaacacg
tacgcgatgctcaccacgttcaacgaaatcgacatgacgaacgtgatgcaaatgcgcgcg
gagtacaaggatgcattcttagaaaaacacggcgtcaagctaggtttcatgagtaccttt
gtcaaggcggcggcgaaggcgcttcaggaagagccctcggtgaacgccatcatcgacggc
gacgaaatcgtgtatagaaactacgttgacatatccgtcgcggtgagcgcgcccaagggt
ttggtggtaccggtgttgagaagctgcgaaggcatgaatttcgccgacgtggaaagctcc
atcgcgtcgtacggtaagaaggctcgcgatggaacgctgtccatcgacgaaatggcgggc
ggtacttttacgatttcaaacggcggcgtgtttggatcgttgacgggcactcccatcatc
aacccgccgcaaagcgccattttgggcatgcattcaatcgtctggcgtccggtgtgcgtc
ggtgccgaccgcgccatcgtcgcgcgcccgatgatgaacgtggcgttgacgtacgatcat
cgcctcgtcgacggtcgcgaagccgtgacatttttgaagtcgattaaggagtctgttgaa
gacccgcgtagaatgatgctcgaagtttaa

DBGET integrated database retrieval system