KEGG   Ostreococcus lucimarinus: OSTLU_119488Help
Entry
OSTLU_119488      CDS       T01029                                 

Gene name
LacZ
Definition
Beta-galactosidase, putative
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
olu  Ostreococcus lucimarinus
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    OSTLU_119488 (LacZ)
  Lipid metabolism
   00600 Sphingolipid metabolism
    OSTLU_119488 (LacZ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    OSTLU_119488 (LacZ)
Enzymes [BR:olu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     OSTLU_119488 (LacZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 1164 aa AA seqDB search
MYFWNLFASFVFRCFSLQGIINFYESWTFRTSRVLSIILRIGECSYATFFDSCVQEQLVS
VDEPLSSAEIADWENASIVGRDRRPSHCTLYSFRTVDECISFWKGGGLWNERINLANVQN
LNGTWKFKLLKNPRAISDEFTLSNFSDTFWAEIPVPANWQCKGWDRPIYTNFQYPFPLHP
PVARTSIKLGIDAGVLCENCVHATNPTGLYRRTFQLDMDWNESYERTFIVFEGVDAAFHI
WINGQLVGYSQDSKMTAEFDVSDSLQSGTNLVVVRVYRWCDGSYLEDQDQWWLSGIFRDV
YLYRKRASHICDYSVQTECCDWQSGTWELRVGIEICDTANAYFNNDNKRLRVRLFDSSLR
EISTGTTDKFLIQHYSPDFGTTQEKNIEEVRQYANVCFNISNVAEWSSERPTLYLLAIIL
ESESGECLDCEGCRVGFRTVQIFNKQLLVNEKRITFQGVNRHEHCPVEGKAVSEKLMIED
ILLMKRNNFNAVRTSHYPNHPRFYELCDEYGLYVIDEANIETHGFEFGLHSTPYLANDPV
WRNAYMSRVSRMVQRDKNHCSIIIWSLGNESGCGGAHFAMYSWVKQNDKTRPIQYEGGGF
KTKCTDIICPMYATPKICQDLASQMDDRPVILCEYSHAMGNSNGGLAKYWEVFRSNRSAQ
GGFIWDLIDQGLNCSTNGRIHWGYGGDFGDSPNDKQFCINGLVFPDRSPHPAMEEVKYLQ
QPTMIRAQGDKIIVENRYHFTNLECMKFDWCVILDSGFILKKGQFSKLHIQPGAETSYEW
SQLFPSLSSLAQLVQRKQFVFGEWWIDVSASFIKHQSWIPEGVSIAKCQLMLPQQKVPVP
GSLNSEAAIHIEHLSDAIWVTSQDSTYVFNAASGRLLKFQFRGEMLIQSGPIASLWRAPT
DNDSGGWIFSFAERWAKAGLDTLHEHEEAVETFVDNFGRFHCASKLVLRTAQKKTVCRLC
SHYTVLASGHLNVTCTFDLSPHLPPLPRIGVLMQCRATMQQVEWLGLGPHENYLDRKSSA
FLGRHSATVDDLHVPYIVPSDNGARQEVRWLALESSASGNKCLFTSKENFNFNASNFSDA
ELARANHQHDLQRSDSIHVHLDTFQMGLGGDCSWFPCVHSEFLAPARKRFTFTFVIAGVG
GNENPSDVFQELRFSRDTVELTSS
NT seq 3495 nt NT seq  +upstreamnt  +downstreamnt
atgtacttttggaacctctttgcaagcttcgtgtttcgttgctttagtctccagggaata
atcaacttttacgaaagctggacttttcgcacatcgcgcgtgctatcaattatactcaga
atcggggagtgttcctacgcaacctttttcgacagttgcgttcaggagcaactggtttca
gtagacgagcctttatcgtcggccgaaatcgccgactgggagaacgcatctattgttggt
cgtgatcgaaggccaagtcactgcaccttatattctttcagaactgtggacgaatgtata
tctttctggaaaggtggaggcctctggaatgagagaattaatttagccaacgttcagaac
ctgaatggcacgtggaagttcaagcttctgaagaatccacgcgccatatctgatgaattt
acactgtcaaacttctcagacacgttctgggcagagattccagtccctgcaaattggcaa
tgcaaaggatgggatcgacctatttacacaaactttcaatatccttttccattgcatcca
ccagtcgcgcgtacgtctattaagctaggtattgatgctggtgttctgtgtgaaaactgc
gtgcacgcgacaaatccgacgggcctgtacaggcgaaccttccagctagatatggactgg
aatgaatcatatgaaaggactttcatcgtgtttgagggggtcgatgcagcgtttcatata
tggatcaatggtcaacttgtcggttactctcaagatagcaaaatgaccgccgaattcgac
gtatcagattctttgcaaagcgggactaacttggtggtggtccgcgtttatcgatggtgc
gatggtagttacttagaggatcaagatcaatggtggctcagtggaatattcagagatgtt
tatttgtatcgtaaaagagcgtcacatatctgcgattactccgtgcagacagagtgttgt
gattggcagtcaggcacatgggagcttcgagttgggattgaaatttgtgacaccgccaat
gcgtacttcaacaatgacaataaacgtcttcgtgttcgtctttttgattcttccttacgt
gaaatatctactggaactacggacaagtttcttatccaacactattcacctgattttggt
acaacgcaagaaaaaaacatagaggaagttaggcaatatgcaaatgtatgcttcaacata
agcaacgtggcagaatggtcgtctgagcgtccaacgctttatctacttgccattattttg
gagagtgaatctggagagtgtttagactgcgaagggtgcagagtaggctttcgaactgtc
cagattttcaacaaacaactattagtgaacgaaaaacgaatcacttttcaaggagtaaat
agacatgaacactgccctgtagagggaaaggcggtatcggagaagctcatgatagaggac
attttgctgatgaaacgtaacaatttcaacgcagtgcgcacttcacattatccgaatcat
ccgaggttttatgagttgtgtgatgaatacggattgtacgttattgatgaggccaatatt
gagacacatgggtttgagtttggcttacattcgacgccatatctagcaaatgatcctgta
tggagaaatgcatacatgtccagagtatcacgcatggtacaacgcgacaaaaatcattgc
tctatcattatttggtcacttggcaatgagtcaggttgtggcggcgctcactttgctatg
tattcatgggtaaaacaaaatgacaaaacccgtccaattcaatatgaaggtggtggcttc
aagacaaagtgcaccgatattatttgtcccatgtatgcaacacctaagatttgccaagat
cttgcatcacagatggatgatcgaccagtcattttgtgtgagtattctcatgccatggga
aatagcaatggtggtctcgccaaatattgggaagtgtttcggagcaaccgtagtgcgcaa
ggagggttcatatgggaccttatcgatcaaggattaaactgttcaacaaatgggcgaatt
cattggggctatggcggagattttggagattcaccaaacgataagcagttttgtatcaac
gggttggtcttcccagaccgttcgcctcatcctgccatggaagaagtgaagtatctccaa
caacctacgatgatacgcgcacaaggagataagattatcgttgaaaatcgatatcacttt
acaaatctcgagtgtatgaagttcgactggtgcgtgattctcgatagtggcttcatactt
aagaaaggccaatttagcaaacttcacattcaaccgggagcagaaacttcttacgaatgg
tcccagttattcccatcactatcatctctcgcgcagcttgtccagaggaagcagtttgtg
tttggagaatggtggattgacgtatcggcttcgttcatcaaacatcagtcttggatacct
gaaggtgtgagtattgcaaagtgtcagcttatgttgccgcaacaaaaagtccctgttccg
ggaagcttgaacagtgaagctgcaattcatatagagcatttgagtgatgcgatttgggtc
acttcgcaagacagcacatatgttttcaatgcagcttccggtagattattgaagtttcaa
tttcgcggcgaaatgttgattcaatcaggcccgatagcgagtttatggcgagctccaaca
gacaatgacagtggtggttggattttttcttttgccgagcgatgggccaaagcaggactg
gatactttgcatgagcacgaagaagctgtcgaaactttcgtagacaacttcggaagattt
cattgtgctagtaagcttgtgcttcgaactgctcaaaagaaaactgtatgtcgtctttgc
tctcattacacggtcttggcgtctggtcatctaaatgttacttgcacattcgatttatca
cctcatttaccacctcttcctcgaattggagttctgatgcaatgtcgagcaaccatgcaa
caagttgagtggcttggacttggtccacatgaaaattatttagatagaaagtcctctgcg
tttctgggtcgccactccgcaactgttgacgatcttcatgttccatatatagtaccaagt
gataatggtgctcgccaagaagtgcgctggctggctttagaatcttccgcaagcggaaat
aagtgcttgttcacgagcaaggagaatttcaatttcaatgcgtcaaatttctctgacgct
gaactggcgcgagccaaccaccagcacgatcttcagcgaagtgacagtattcacgtacat
ttagatacattccaaatgggtttaggaggagactgcagttggtttccatgtgtgcactct
gaatttcttgcacctgctcggaagcgtttcacttttacttttgtcatcgcaggagttgga
ggaaacgaaaacccaagtgatgtttttcaagaattgcgattttcgcgtgacacagtcgaa
ctcacttcatcgtga

DBGET integrated database retrieval system