KEGG   Ostreococcus lucimarinus: OSTLU_119495Help
Entry
OSTLU_119495      CDS       T01029                                 

Gene name
ChlI
Definition
Magnesium-protoporyphyrin IX chelatase subunit chlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
olu  Ostreococcus lucimarinus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:olu00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 397 aa AA seqDB search
MSAAVSYSHQHVNALCRWSRGYKNIQGTRGCRVQQTLRPKAVSNDSEVEDSTARPVYPFC
AIIGQEEMKFAALMNIIDPNIGGIMVMGDRGTGKSTTVRSLTDLLPYIEIVKDDPFMSSP
TDPNLMSPDVLSAYRAKQPLETSFVPINMVDLPLGATEDRVCGTIDIEKALTEGTKAFEP
GLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVEREGISICHPARFILIGSGNPE
EGELRPQLLDRFGMHAQIKTVKLPEERVKVVEERTAFDTDPKSFRAGYKAKQDEIIDQVT
RARALLPEVEVPMEIRLKISQVCAELDVDGLRGDLVTTRASRAAAAFRGSKVVTDEDVYS
VVSLCLRHRLRKDPMATIDEGSRVIDVFSSVFGYETD
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgctgtttcatacagtcatcaacacgtaaacgcgctctgtagatggagccgg
ggatataagaacattcaaggcacgcgtggctgccgcgtgcagcagacacttcgccctaaa
gccgtttccaacgattccgaggtggaggatagtaccgctagacctgtatatcccttctgc
gctatcattggccaagaagagatgaagttcgcagcgctgatgaacatcatcgatccgaat
atcggcggcatcatggtgatgggcgatcgtgggactgggaagtcgacgacagtccgttcg
ttgactgatttacttccatacatcgaaatcgtgaaagatgatccgtttatgagtagccct
acggatccgaacttgatgtctcccgacgttttatcggcatatcgggccaagcaaccgctc
gagacttccttcgttcctatcaatatggttgacttacccttgggtgcaactgaggatcgc
gtatgcgggacgatcgatatcgagaaagcgttaactgaggggacgaaagccttcgaacct
ggtctcctcgccaaggcgaatcgcggaatactgtatgttgatgaagtcaacttactagac
gaccaccttgttgatgttttgcttgattcggcagcgtcgggctggaatacagtggagcgc
gagggaatcagtatatgtcacccggctcgtttcatcctcattggttccggtaacccagaa
gaaggcgaactgcgaccccagcttttagatcgcttcggcatgcatgcacaaatcaagact
gtgaaactgccagaagagcgggtcaaggttgtcgaagagcggactgcatttgacacggat
ccgaagtcgttccgcgcgggatacaaggcaaagcaggacgaaatcatagaccaggtgact
cgggcgcgcgccttgttaccggaggttgaggttcccatggaaatccgactgaaaatttcc
caagtctgcgctgagcttgacgtcgatggcctccgtggtgatctcgtgacgactcgcgca
tcacgtgcagctgcagccttccgaggttccaaggtagtgaccgacgaagacgtttattcg
gtagtgtcgctctgcctgcgtcacaggctccgtaaggatccaatggcgactattgatgaa
ggctctcgagttattgatgtcttttcatctgtgttcggttacgaaacggactga

DBGET integrated database retrieval system