KEGG   Ostreococcus lucimarinus: OSTLU_119518Help
Entry
OSTLU_119518      CDS       T01029                                 

Gene name
Hda
Definition
histone deacetylase, probable
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
olu  Ostreococcus lucimarinus
Brite
Enzymes [BR:olu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     OSTLU_119518 (Hda)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 424 aa AA seqDB search
MVAKERVCYYYDEEVGRNYYGPNHPMKPHRLCMTHNLILAYDLHKHLQVFRPRACTNTEF
TQFHSEDYVDFLSKITPDKQQQYVLEMQRFNLGEDCPIFDHMLDFCRRYTGGSIDGVRRL
NQGVSDIAINWSGGLHHAKKAEASGFCYINDLVLAILELLKQHARVVYIDIDIHHGDGVE
EAFYMTDRVMTVSFHKYGDMFFPGTGGLRDIGINSGKYYSVNVPLNDGIDDKSFVDLFKF
VMQDVMDSFQPGAIVLQCGADSLAGDRIGCFNLSLKGHAECVSFMKSFAKPILVTGGGGY
TKSNVARCWANETATLLGKQLVEHIPPHENYYEYYADAGYKLKAHAPVWIENLNTPSYLN
QVKEKVRQNLKSLTFAPSVEFSEAPPAVLVPELDESDLNPDERYGGSLGQDSVVISKEEF
YEND
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccaaggaaagggtgtgctactactatgacgaagaagttggtagaaactactac
gggccgaaccaccccatgaagcctcatcgcttgtgcatgacgcacaatttgattttggcc
tatgatttgcataaacacctgcaagttttcaggccacgagcctgcacgaacacagaattc
actcagtttcatagcgaagattacgtcgatttcttgtcaaaaataactcctgacaagcag
caacaatacgttttagaaatgcaaagattcaaccttggcgaagactgccccattttcgat
cacatgcttgacttttgtcgacggtacacaggtgggtccattgacggagtccggcgattg
aatcagggggtatcagacattgccataaactggtctggaggtttacaccatgcaaagaag
gcagaagcttcgggattttgctacatcaacgacctcgtgttagcgatactagaactcctg
aagcaacatgcacgggtcgtgtacatagatatagatattcatcacggtgacggagtggaa
gaagcattttacatgactgatcgagtgatgaccgtcagttttcataaatatggcgatatg
ttcttcccgggcacaggtggtttgagggacatcggcataaactcgggaaaatactacagt
gtcaatgtgcccttgaatgatggcatagatgacaaaagctttgtggatctattcaaattt
gtcatgcaagacgtgatggattcattccaaccaggcgccatcgtcctccaatgcggcgct
gattcactagctggcgatcgaatcggttgctttaacctttcactgaaaggtcacgcagaa
tgtgtttccttcatgaaaagttttgcgaagccgatacttgttacaggtggcggaggctat
acgaaatccaatgtagccagatgctgggcgaatgagacagcaactctcctaggtaaacaa
ctggtagaacatattccaccgcacgagaactattacgagtattacgccgatgcaggatac
aagttgaaggcacacgcgccggtgtggatagaaaatttgaacacaccttcatacttgaat
caggtgaaagaaaaagttcggcaaaacttgaaatccctcacgttcgcaccgagtgttgaa
ttcagcgaagcacctcccgccgtcctcgtaccggagttggacgagagtgatctgaaccca
gacgaaagatatggcgggagtttgggtcaagacagcgtcgtcataagtaaggaagagttc
tacgaaaacgactaa

DBGET integrated database retrieval system