KEGG   Ostreococcus lucimarinus: OSTLU_119552Help
Entry
OSTLU_119552      CDS       T01029                                 

Gene name
If4E
Definition
eukaryotic translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
olu  Ostreococcus lucimarinus
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:olu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    OSTLU_119552 (If4E)
Translation factors [BR:olu03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    OSTLU_119552 (If4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 129 aa AA seqDB search
MGTDFHLFKEGIEPKWEDETCAKGGKWTYYVPKQKDGEELDESWLNLLLCMIGEQFSETT
EVCGAVISVRQKQHRIALWTKTASSEPEQVAIGRHLKDILDIPESEKIGYMVHDDAIRLE
RRAKDRYTV
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgggtacggattttcatttgttcaaggagggcatcgagccaaagtgggaagatgagaca
tgcgcaaaaggtggcaaatggacatattatgtcccaaagcagaaagatggggaagagctt
gacgaaagttggttgaatcttcttttgtgtatgattggcgagcaattcagtgaaaccacc
gaagtttgcggagccgtcatcagtgtgcggcagaagcagcatcgaatcgccttgtggaca
aagacagcgtcaagcgaacctgaacaggtagctattggtcgacatttgaaagacattttg
gacatccctgaaagtgagaaaatcgggtacatggtacacgatgatgccattcgactggag
cgtagggcaaaggatcggtacaccgtttga

DBGET integrated database retrieval system