KEGG   Ostreococcus lucimarinus: OSTLU_12608Help
Entry
OSTLU_12608       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
olu  Ostreococcus lucimarinus
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:olu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    OSTLU_12608
Messenger RNA biogenesis [BR:olu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     OSTLU_12608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 345 aa AA seqDB search
MSWGQAATQAPANPNGDFLVANPPNDGISSLSWSPTGNFLVATAWDGDVYCYEVANNGQA
MPKASTKHEAPVLCSSWSSDGASVFTGGCDNIAKKWDLASGQATQIAQHDGAIRHMAWIE
QVGLLVTGSWDRTLKYWDTRQPNPALQVQLPERCYALDVTHPLLVVGCAERQIQIFNLSN
PQVPYKQLLSPLKYQTRCVATFPDRSGYLVGSIEGRVAVQHVEDNLQSKNFTFKCHREGT
QDIYAVNSISFHPTFGTFVTAGADGNFNFWDKDSKQRLKNMTKCSAPISCGNFNRDGTIY
AYAVSYDWSKGGDNPLSNTPNNIYLHAVNETEVKPRPAKSGIGRR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggggacaggcggcgacgcaggcgccggcgaacccgaacggggactttctggtg
gcgaatccgccgaacgatgggataagctcgctgtcgtggtcgccgacggggaattttttg
gtggcgacggcgtgggacggagacgtgtattgctatgaggtggcgaacaatgggcaggcg
atgccgaaggcgtcgacgaagcacgaggcgccggtgctgtgtagctcgtggtcgagcgac
ggcgcgagcgtgttcacgggcgggtgcgataacatcgcgaagaaatgggacttggcgagc
gggcaggcgacgcagatcgcgcagcacgatggggcgatcagacacatggcgtggatcgaa
caggtggggttgttagtcaccggatcttgggatcgaacgttgaagtattgggacacgcgt
cagccgaatcccgcgctccaggttcagctccccgaacggtgttacgcgttagatgtcacg
caccctttgctcgtcgtgggatgtgccgagagacagattcagattttcaacttgagcaac
ccgcaagtgccgtacaagcagttgttatcgccgctcaagtatcagacgcgatgcgtcgcc
acgtttcccgatcgctcgggctacttggtcggctccatcgaaggacgcgtcgcggttcag
cacgtggaagacaatttgcaaagcaagaactttactttcaaatgtcacagagaaggcacg
caagacatttacgccgtcaactccatctcgttccacccgacgtttggaacgttcgtcacc
gcgggcgccgacggcaacttcaacttttgggacaaggatagtaagcaacgcctaaagaac
atgaccaagtgttcggcacccatctcgtgcgggaacttcaatcgcgatgggacgatttac
gcgtacgcggtgtcgtacgattggagcaagggcggtgacaacccgctgtcaaacacgccg
aataacatttacttgcacgccgtgaacgaaacagaagtcaagccgcggccggcgaagagc
ggaatcggtcgtcgataa

DBGET integrated database retrieval system