KEGG   Ostreococcus lucimarinus: OSTLU_12650Help
Entry
OSTLU_12650       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
olu  Ostreococcus lucimarinus
Pathway
Regulation of autophagy
Class
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:olu04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 528 aa AA seqDB search
MEGGEDSGTHASGGASRGQAEIYLPNYRIGKTLGIGSFGKVKVAEHVLTGHKVAIKILNR
KKIKAIDMEEKVRREIKILRLFMHPHIIRLYEILETPHDIFLVMEYVKSGELFDYIVEKG
RLGENEARHFFQQIISGVEYCHRNMVVHRDLKPENLLLDSRNNVKIADFGLSNVMRDGHF
LKTSCGSPNYAAPEVISGKLYSGPEVDVWSCGVILYALLCGSLPFDDESIPNLFKKIKGG
VYSLPSHLSPGARDLISRMLFVDPLKRITMAEIRHHQWFVVHLPRYLVVPPQTQISQTSN
LDGETLDMVINLGFEREPLIDALRHQIRNKATVTYYLLLDNRRNIYGGYLGAEYDDAEIM
AEHNNMRHGVASALGVRRPSQVHAHMMQQRLVAEQRWMLGTASKMGALDVFNELIRVLRV
MDVSWKKNGPYNMKCMCVLHCHGDAMDNDMADGDVAAGDQDAMDEDLGVTTPPMSEDGRQ
REPTVLKFELQVYKMPNDRLMVDFQRVDGGVMISLDIAAKLMKLLELH
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggagggcggggaggacagcgggacgcacgcgagcgggggggcgtcgcgagggcaagcg
gagatttacctgccgaactatcgcatcgggaagacgctcgggatcgggtcgttcgggaag
gtgaaagtggcggaacacgtgctgacgggacacaaggtggcgatcaagattttgaatcgg
aagaagatcaaggcgatcgacatggaggaaaaggtgcgacgggagattaagattttgcgg
ctgttcatgcatccgcacatcattcggttgtacgagatattggagacgccgcacgacatc
tttttggtgatggagtacgtgaagtcgggcgagttgttcgattacatcgtggagaaggga
cgattgggggaaaacgaggcgaggcatttctttcaacaaatcatatcgggggtggagtat
tgccatcggaatatggtcgtgcatcgcgacttgaagccggaaaacttgttgctggattcg
cggaataacgtcaagattgcggatttcgggttgtcgaacgtcatgcgggacggtcacttt
ttgaagacgtcgtgcgggagtcccaactacgccgcgccagaggtgattagcggcaagctg
tacagcggccccgaggtggacgtgtggagttgcggggtgattttgtacgcgcttctgtgt
ggatcgttgcctttcgacgatgaaagcatcccaaacttgtttaaaaagatcaagggtggg
gtatatagcttaccaagccatctgagcccgggggcgcgagacttaatatcgcgcatgctc
ttcgtagacccgctcaagcgaatcaccatggcggagattcgtcaccatcagtggttcgtc
gtgcatctaccgcgctatctcgtggtaccgccgcaaacgcagatatcgcaaacatccaat
ctcgatggggagactttggatatggtgatcaacttaggctttgagcgcgaaccgttgatt
gacgctctaaggcatcaaatccgtaacaaggcgacggtgacgtattacttgctactggac
aataggcgaaacatatacggtgggtacttaggcgccgaatacgacgatgcagagatcatg
gcggaacacaacaacatgcgacacggcgtcgcgtctgcactaggcgtgcgacgaccgagt
caagtgcacgcgcacatgatgcaacagcgtctcgtcgccgagcagcgttggatgcttgga
acggcttcaaagatgggcgcactagacgttttcaacgagttgattcgcgtattacgcgtg
atggacgtgtcttggaagaagaacggaccgtataacatgaagtgcatgtgcgttctccac
tgccacggcgacgctatggacaacgacatggcggacggtgacgtcgcggcgggcgatcaa
gacgcgatggacgaagacctcggcgtcacgacaccaccaatgagcgaagacggtcgacag
cgtgagcctacggtgttgaagtttgaactccaagtgtacaagatgccaaacgataggcta
atggtggatttccagcgcgtggatggaggtgtgatgatttcgctcgatatcgccgcaaag
ctcatgaaattgctcgaattgcattag

DBGET integrated database retrieval system