KEGG   Ostreococcus lucimarinus: OSTLU_12779Help
Entry
OSTLU_12779       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
olu  Ostreococcus lucimarinus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    OSTLU_12779
  Metabolism of other amino acids
   00480 Glutathione metabolism
    OSTLU_12779
Enzymes [BR:olu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     OSTLU_12779
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 178 aa AA seqDB search
MGASHSAPTPDVDDVQSLDQLPSARTATGEDFDFKSTRNKVTLVVNVASACGLTTKNYAD
FASLQDRFGDDLVILAFPCNQFLFQESGSSKSICAFAQKRGFKGTVFEKCKVNGKAASHV
FRWLKRAQRVRRVQWNFGKFLVDRKGRVRGYFSPHTRPMEFEDAIKALLDEPVDADAS
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgggagcctcccactccgccccgacgcccgacgtggacgacgtgcaaagcttagatcaa
ctcccgagcgcgcgcacggccaccggcgaggacttcgacttcaaatcgacgcgcaataag
gtcaccctagtcgtcaacgtggcgagtgcttgcgggctcacgacgaaaaactatgcggat
ttcgcatctctgcaggaccgattcggcgacgatctagtcatcctggcgttcccgtgcaat
cagttcttgttccaggagagcgggagctcgaagtcgatctgcgcgttcgcgcaaaagcgt
ggcttcaagggcaccgtttttgagaaatgcaaggtgaacggcaaggcggcgtcgcacgtg
tttcgttggctgaagcgcgcgcagcgcgtgaggcgcgtgcagtggaatttcgggaagttt
ttagtggatagaaaaggacgcgtgcgcgggtatttttctccgcacacgcggcccatggag
ttcgaggacgcgataaaggcgctgttagacgagccagtcgacgcggacgcgagttag

DBGET integrated database retrieval system