KEGG   Ostreococcus lucimarinus: OSTLU_12779Help
Entry
OSTLU_12779       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
olu  Ostreococcus lucimarinus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:olu00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:olu00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 178 aa AA seqDB search
MGASHSAPTPDVDDVQSLDQLPSARTATGEDFDFKSTRNKVTLVVNVASACGLTTKNYAD
FASLQDRFGDDLVILAFPCNQFLFQESGSSKSICAFAQKRGFKGTVFEKCKVNGKAASHV
FRWLKRAQRVRRVQWNFGKFLVDRKGRVRGYFSPHTRPMEFEDAIKALLDEPVDADAS
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgggagcctcccactccgccccgacgcccgacgtggacgacgtgcaaagcttagatcaa
ctcccgagcgcgcgcacggccaccggcgaggacttcgacttcaaatcgacgcgcaataag
gtcaccctagtcgtcaacgtggcgagtgcttgcgggctcacgacgaaaaactatgcggat
ttcgcatctctgcaggaccgattcggcgacgatctagtcatcctggcgttcccgtgcaat
cagttcttgttccaggagagcgggagctcgaagtcgatctgcgcgttcgcgcaaaagcgt
ggcttcaagggcaccgtttttgagaaatgcaaggtgaacggcaaggcggcgtcgcacgtg
tttcgttggctgaagcgcgcgcagcgcgtgaggcgcgtgcagtggaatttcgggaagttt
ttagtggatagaaaaggacgcgtgcgcgggtatttttctccgcacacgcggcccatggag
ttcgaggacgcgataaaggcgctgttagacgagccagtcgacgcggacgcgagttag

DBGET integrated database retrieval system