KEGG   Ostreococcus lucimarinus: OSTLU_12804Help
Entry
OSTLU_12804       CDS       T01029                                 

Gene name
HTB3501
Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
olu  Ostreococcus lucimarinus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 112 aa AA seqDB search
MAKKPAQKKPSGAKKVGRKSKSETYKIYIYKVLKQVHPDTGISSKAMSIMNSFINDIFEK
IATEAAKLARYNKKPTVTSREIQTAVRLILPGELAKHAVSEGTKAVTKFTSA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaagcccgcgcaaaagaagccctcgggcgccaagaaggttggacgcaagtcc
aagtccgaaacctacaagatctacatctacaaggtcttgaagcaagtgcacccggacacc
ggtatctcctccaaggcgatgtccatcatgaactcgttcatcaacgacatcttcgagaag
atcgccacggaagccgccaagctcgcgcgatacaacaagaagccgacggtcacgtcccgc
gaaatccaaaccgcggtccgattgatcttgccgggtgaactcgccaagcacgccgtctcc
gaaggcaccaaggccgtcaccaagttcacctccgcgtaa

DBGET integrated database retrieval system