KEGG   Ostreococcus lucimarinus: OSTLU_13105Help
Entry
OSTLU_13105       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K11252  histone H2B
Organism
olu  Ostreococcus lucimarinus
Brite
Chromosome and associated proteins [BR:olu03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    OSTLU_13105
Exosome [BR:olu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   OSTLU_13105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 5004636
NCBI-ProteinID: XP_001420602
JGI: 13105
UniProt: A4S1C9
Position
12:152390..152728
Genome map
AA seq 112 aa AA seqDB search
MAKKPAQKKPSGAKKVGRKSKSETYKIYIYKVLKQVHPDTGISSKAMSIMNSFINDIFEK
IATEAAKLARYNKKPTVTSREIQTAVRLILPGELAKHAVSEGTKAVTKFTSA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaaacccgcgcaaaagaagccctcgggcgccaagaaggttggacgcaagtcc
aagtccgaaacctacaagatctacatctacaaggtcttgaagcaagtgcacccggacacc
ggtatctcctccaaggcgatgtccatcatgaactcgttcatcaacgacatcttcgagaag
atcgccacggaagccgccaagctcgcgcgatacaacaagaagccgacggtcacgtcccgc
gaaatccaaaccgcggtccgattgatcttgccgggtgaactcgccaagcacgccgtctcc
gaaggcaccaaggctgtcaccaagttcacctccgcgtaa

DBGET integrated database retrieval system