KEGG   Ostreococcus lucimarinus: OSTLU_13105Help
Entry
OSTLU_13105       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
olu  Ostreococcus lucimarinus
Brite
Exosome [BR:olu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   OSTLU_13105
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
12
AA seq 112 aa AA seqDB search
MAKKPAQKKPSGAKKVGRKSKSETYKIYIYKVLKQVHPDTGISSKAMSIMNSFINDIFEK
IATEAAKLARYNKKPTVTSREIQTAVRLILPGELAKHAVSEGTKAVTKFTSA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaaacccgcgcaaaagaagccctcgggcgccaagaaggttggacgcaagtcc
aagtccgaaacctacaagatctacatctacaaggtcttgaagcaagtgcacccggacacc
ggtatctcctccaaggcgatgtccatcatgaactcgttcatcaacgacatcttcgagaag
atcgccacggaagccgccaagctcgcgcgatacaacaagaagccgacggtcacgtcccgc
gaaatccaaaccgcggtccgattgatcttgccgggtgaactcgccaagcacgccgtctcc
gaaggcaccaaggctgtcaccaagttcacctccgcgtaa

DBGET integrated database retrieval system