KEGG   Ostreococcus lucimarinus: OSTLU_13980Help
Entry
OSTLU_13980       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00340  Histidine metabolism
olu01100  Metabolic pathways
olu01110  Biosynthesis of secondary metabolites
olu01230  Biosynthesis of amino acids
Module
olu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    OSTLU_13980
Enzymes [BR:olu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     OSTLU_13980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-GeneID: 4999608
NCBI-ProteinID: XP_001415655
JGI: 13980
UniProt: A4RS01
Position
1:983587..984876
Genome map
AA seq 429 aa AA seqDB search
MRTYVERDLTAEERVEVMRRPRVDFTSILDTVKPIVEAVGTRGDAAVREYTSKFDGVDLE
AVTVRVDELPDPVLDDDVKKAFDVAYDNIAAFHAAQAKSGDVDVTTMPGVRCRRVSRPIG
AVGLYVPGGTAVLPSTALMLAVPAKIAGCERVVLATPPRKDGSIVPEVLYVAKKAGVTHI
LKAGGAQAIAAMGFGTETCPKVDKLFGPGNQFVTAAKMSLQNSDAMVSIDMPAGPSEVLV
IADKDAPAAHVAADLLSQAEHGPDSQVVLVTFPDVDLKAITDAVADQASKLPRAEITAKA
LGHSYAVVVDDMAAACDFSNRYAPEHLIVNVENAESWLPQLDNAGSIFLGRWTPESVGDY
ASGTNHVLPTYGYSRMYSGVSLDSFVKYMTVQELTKEGLDALGPHVARMAAVEGLDAHRS
AVTLRLGID
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgcggacgtacgtcgagcgcgatctcaccgcggaagagcgcgtggaggtgatgcgtcga
ccgcgggtggactttacgagcatcctggacacggtgaagccgatcgtggaggcggtggga
acgcgcggggacgcggcggtgcgcgagtacacgagcaagttcgacggcgtcgatttggaa
gcggtgacggtgcgcgtggatgaattgcccgatcccgtgctggatgatgatgtgaagaag
gcgtttgacgtggcgtacgacaatatcgcggcgtttcacgcggcgcaggcgaagagcggg
gacgtggacgtgacgacgatgccaggggtgcgctgtcgacgcgtgtcgagaccgatcgga
gcggtcggactgtacgtcccgggcggcaccgcggtgttaccgagcacggcgctcatgctc
gcggtgccggcgaagattgccgggtgcgaacgcgtcgtgctcgcgacgccgccgcgcaag
gatggttccatcgttccggaggtgctgtacgtggcgaaaaaggcgggggtgacgcacatt
ctcaaggctggcggcgcgcaagcgatcgcggcgatgggattcggcacggaaacgtgcccg
aaggtggataagctcttcggtccggggaatcagtttgtgacggcggcgaagatgtcgctg
caaaactcagacgcgatggtttccatcgacatgcccgcgggcccgagtgaggtgctcgtc
atcgcggataaagacgcccccgccgcccacgtcgccgccgatctcttgtctcaagccgag
cacgggccggacagccaggtggttttggtgacgttcccggacgtggatttgaaggctatc
acggacgccgtggcggaccaagcgagcaagctcccgcgcgccgaaatcaccgccaaggcg
ctcggccactcctacgccgtcgtcgttgacgacatggcggccgcgtgcgattttagcaat
cgatacgctcccgagcacttgatcgtaaacgtcgaaaatgcggaatcatggttaccgcag
ttagacaacgccggttccatcttcctcgggcgctggaccccagaatccgtgggcgattac
gccagcggcaccaaccacgttttacccacctatggctactctcgcatgtactccggcgta
tccttggactctttcgttaagtacatgacggttcaagagctcaccaaggaaggtttagac
gcgctcggtcctcacgtcgccaggatggcggcggtcgaaggtttggacgcgcacagatcc
gccgtgactttacgcttaggcatcgactag

DBGET integrated database retrieval system