KEGG   Ostreococcus lucimarinus: OSTLU_15043Help
Entry
OSTLU_15043       CDS       T01029                                 

Gene name
CYC1
Definition
(RefSeq) predicted protein
  KO
K08738  
cytochrome c
Organism
olu  Ostreococcus lucimarinus
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    OSTLU_15043 (CYC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
4:join(459603..459645,459807..459874,460047..460274)
Genome map
AA seq 112 aa AA seqDB search
MSTFSEAPAGNAAKGAKIFKTKCAQCHVAEKGGGHKQGPNLGGLFGRVSGTTEGFSYSAA
NKNKGVTWSENTLYDYLLNPKKYIPGTKMVFAGLKKPEDRADLIAYLKESTK
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgttcagcgaagcgccggcggggaacgccgcgaagggagcgaagatttttaag
acgaagtgcgcgcagtgccacgtcgcggagaagggcggtggacacaagcagggtcctaac
ctcggcggcttgttcggccgcgtctccggcaccacggagggtttctcgtacagcgcggcg
aacaagaacaagggcgtcacatggagcgagaacaccctgtacgactacctgttgaacccg
aagaagtacattccgggcacgaagatggtcttcgccggtctgaagaagccggaagaccgc
gcggatttgatcgcgtacctgaaggagagcaccaagtag

DBGET integrated database retrieval system