KEGG   Ostreococcus lucimarinus: OSTLU_15043Help
Entry
OSTLU_15043       CDS       T01029                                 

Gene name
CYC1
Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
olu  Ostreococcus lucimarinus
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:olu00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 112 aa AA seqDB search
MSTFSEAPAGNAAKGAKIFKTKCAQCHVAEKGGGHKQGPNLGGLFGRVSGTTEGFSYSAA
NKNKGVTWSENTLYDYLLNPKKYIPGTKMVFAGLKKPEDRADLIAYLKESTK
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgttcagcgaagcgccggcggggaacgccgcgaagggagcgaagatttttaag
acgaagtgcgcgcagtgccacgtcgcggagaagggcggtggacacaagcagggtcctaac
ctcggcggcttgttcggccgcgtctccggcaccacggagggtttctcgtacagcgcggcg
aacaagaacaagggcgtcacatggagcgagaacaccctgtacgactacctgttgaacccg
aagaagtacattccgggcacgaagatggtcttcgccggtctgaagaagccggaagaccgc
gcggatttgatcgcgtacctgaaggagagcaccaagtag

DBGET integrated database retrieval system