KEGG   Ostreococcus lucimarinus: OSTLU_17041Help
Entry
OSTLU_17041       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.1.2.15]
Organism
olu  Ostreococcus lucimarinus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 379 aa AA seqDB search
MWRGVASEGKHMSAWERETARSERRRPARETGGIENLGNSCYIAASLQLLRSMRGFVESV
HEVSGDEDGKPLLAALGEFFRSDASELSASGVKREMGRVRDEYGEFDQHDAMEFMTQMLD
TIEREMGDDAAHCPSRQNFAWRIEHALSCVSCGERSVMDESMYMLTLQLIIDENESVDAL
LDRYFIPEKLERKCSCGCLFAISTRQIVSEPKFLLLHLKRFNAVIARGVLRLQKLTASIR
LPSKMSLMHAGSAAAEIVVPKSSGDDSDLEHANNASKSSPDTPGVKRHNTRSVAATRPFD
LLAVISHHGNTVELGHFVAHIRERKSKAWKTYDDERVTSYVARDELIFNSLQEFERECYV
VAYERDDNENLRQGNAQIF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgaggggtggcgagcgaggggaagcacatgtcggcgtgggagcgcgagacggcg
cggagcgagcgacggcgaccggcgcgcgagacgggcgggattgaaaatttagggaattcg
tgctacatcgccgcgtctttgcagttgttgcgaagcatgcgtggattcgtggagtcggtt
cacgaggtgtctggagacgaggacggtaaaccgttactcgccgcgctcggcgagtttttc
agatcggacgcgagcgagttgagcgcgtcgggcgtgaagcgcgaaatgggtcgcgtgcgg
gacgagtacggagagttcgatcaacacgacgcaatggaattcatgacgcaaatgttggac
acgatcgagcgcgaaatgggtgacgacgcggcgcactgtccgagtcgacaaaacttcgcg
tggcgcatcgagcacgcgctatcgtgcgtcagctgcggcgaaaggagcgtgatggacgaa
tcgatgtacatgctgacgttgcagctcatcatcgacgagaacgagtctgtcgacgcgctg
ctcgatcggtacttcattccagaaaagctcgaacgcaagtgttcgtgtggatgcttgttc
gcaatctcgactcgacaaatcgtctcagagccgaaattcctcctcttgcacctcaagcga
ttcaatgcggtgatagcgcgcggtgtgttgcgtttgcaaaagctcacggcttcgattcgt
cttccttcaaagatgtcgctgatgcacgctggatccgccgccgccgaaatcgtcgtcccc
aaatcgtctggagacgattcggatctcgaacacgctaacaacgcgtccaaaagttcgccc
gataccccgggtgtgaagcgtcacaacacgcgatcggtggcggctacgagaccgttcgac
ttgctcgccgtcatctcgcaccacgggaacacggttgagctcgggcacttcgtcgcgcac
atccgcgagcgcaaatcgaaggcgtggaagacttacgacgacgagcgcgtgacttcctac
gtggcgcgcgatgagctcattttcaactcgcttcaagaattcgaacgcgagtgctacgtg
gtcgcttacgaacgagacgataacgaaaatcttcgccaaggaaacgcgcaaatattctga

DBGET integrated database retrieval system