KEGG   Ostreococcus lucimarinus: OSTLU_17041Help
Entry
OSTLU_17041       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.1.2.15]
Organism
olu  Ostreococcus lucimarinus
Brite
Enzymes [BR:olu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     OSTLU_17041
Peptidases [BR:olu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   OSTLU_17041
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 379 aa AA seqDB search
MWRGVASEGKHMSAWERETARSERRRPARETGGIENLGNSCYIAASLQLLRSMRGFVESV
HEVSGDEDGKPLLAALGEFFRSDASELSASGVKREMGRVRDEYGEFDQHDAMEFMTQMLD
TIEREMGDDAAHCPSRQNFAWRIEHALSCVSCGERSVMDESMYMLTLQLIIDENESVDAL
LDRYFIPEKLERKCSCGCLFAISTRQIVSEPKFLLLHLKRFNAVIARGVLRLQKLTASIR
LPSKMSLMHAGSAAAEIVVPKSSGDDSDLEHANNASKSSPDTPGVKRHNTRSVAATRPFD
LLAVISHHGNTVELGHFVAHIRERKSKAWKTYDDERVTSYVARDELIFNSLQEFERECYV
VAYERDDNENLRQGNAQIF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgaggggtggcgagcgaggggaagcacatgtcggcgtgggagcgcgagacggcg
cggagcgagcgacggcgaccggcgcgcgagacgggcgggattgaaaatttagggaattcg
tgctacatcgccgcgtctttgcagttgttgcgaagcatgcgtggattcgtggagtcggtt
cacgaggtgtctggagacgaggacggtaaaccgttactcgccgcgctcggcgagtttttc
agatcggacgcgagcgagttgagcgcgtcgggcgtgaagcgcgaaatgggtcgcgtgcgg
gacgagtacggagagttcgatcaacacgacgcaatggaattcatgacgcaaatgttggac
acgatcgagcgcgaaatgggtgacgacgcggcgcactgtccgagtcgacaaaacttcgcg
tggcgcatcgagcacgcgctatcgtgcgtcagctgcggcgaaaggagcgtgatggacgaa
tcgatgtacatgctgacgttgcagctcatcatcgacgagaacgagtctgtcgacgcgctg
ctcgatcggtacttcattccagaaaagctcgaacgcaagtgttcgtgtggatgcttgttc
gcaatctcgactcgacaaatcgtctcagagccgaaattcctcctcttgcacctcaagcga
ttcaatgcggtgatagcgcgcggtgtgttgcgtttgcaaaagctcacggcttcgattcgt
cttccttcaaagatgtcgctgatgcacgctggatccgccgccgccgaaatcgtcgtcccc
aaatcgtctggagacgattcggatctcgaacacgctaacaacgcgtccaaaagttcgccc
gataccccgggtgtgaagcgtcacaacacgcgatcggtggcggctacgagaccgttcgac
ttgctcgccgtcatctcgcaccacgggaacacggttgagctcgggcacttcgtcgcgcac
atccgcgagcgcaaatcgaaggcgtggaagacttacgacgacgagcgcgtgacttcctac
gtggcgcgcgatgagctcattttcaactcgcttcaagaattcgaacgcgagtgctacgtg
gtcgcttacgaacgagacgataacgaaaatcttcgccaaggaaacgcgcaaatattctga

DBGET integrated database retrieval system