KEGG   Ostreococcus lucimarinus: OSTLU_17414Help
Entry
OSTLU_17414       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
olu  Ostreococcus lucimarinus
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    OSTLU_17414
Enzymes [BR:olu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     OSTLU_17414
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
11
AA seq 505 aa AA seqDB search
MATVDAVARVATTGRGRATLVLGDGTRVVRVEDVVRVEVRRRRRRHRHHRDEDDDARTLA
VTAIARRRGFPGISTRKRSARRLKTHETACATAAVANEARTRCAEACGLDDADASGTARE
RRRRVLVIVNPRSGRGEGTKIWETKARAVLEAANIECATRTTKARGEATNIARELDASLY
DGVVAVGGDGTVAELFQGLSEREDREEIYAKMPIGIVPAGSGNALCKSIQHAGGEPCDPV
SCALTIARWRTRALDRSEVRFQDSKTASGWGDDSKVTHSLLSTSWGFFSDVDIESERFRF
LGGARFTLQAIVRILARRKYQCELLYETTEEGEAYNAQHCDGPHGEPVPGRPGWRRVAGD
VLGLWALNVPWGTESTLAAPHAKFDDGSIDVVLVNVTNRKNMLKLLLDFDAGDHARNRAV
RYIKAKSFEIYPAAAAAAAATAAAIVDASSETNATAPGGGGYIAVDGEVLASRRFRAAAA
AAFPYGPFRCDVIRAACAVFAPPSA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgtcgacgcggtcgcgcgcgtcgcgacgaccgggcgcgggcgcgcgacgttg
gttttgggcgacgggacgcgcgtcgtgcgcgtcgaggacgtcgtgcgcgtcgaggttcgg
cgtcgacgtcgtcggcatcggcatcatcgagatgaagacgacgacgcgcggacgctcgcg
gtgacggcgatcgcgcggcgacgcggattcccgggaatatcgacgcgcaagagaagcgcg
cgacggttgaagacgcacgagacggcgtgcgcgacggcggcggtggcgaacgaggcgagg
acgcggtgcgcggaggcgtgcgggctcgacgacgcggacgcgagcgggacggcgagggag
agacggcggcgggtgctggtgatcgtgaatccgcgaagcggacgaggcgaggggacgaag
atatgggagacgaaggcgcgcgcggtgttggaggcggcgaacatcgagtgcgcgacgcgg
acgacgaaggcgcgaggagaggcgacgaacatcgcgcgagagctcgacgcgagtctgtac
gacggcgtcgtcgccgtggggggggacgggaccgtggcggagctgtttcaagggctgagc
gaacgcgaggatcgagaggagatttacgcgaagatgccgatcggaatcgtgccggcgggt
tcggggaacgcgctgtgcaagtcgattcagcacgccggcggcgaaccgtgcgatccggtg
agttgcgcgctgacgatcgcgcggtggcgcacgcgcgcgctcgatcgatcggaagtgcgg
tttcaagattctaaaaccgcatcgggttggggggatgactcgaaagtcacgcactcgctg
ctgtcgacttcgtggggatttttctccgacgtcgacatcgagagcgagcggtttagattt
ctaggaggcgcgcgattcacgctgcaggccatcgtgcggatattagccagaagaaagtac
cagtgcgaacttttatacgaaaccaccgaagagggcgaggcgtacaacgcccaacactgc
gacgggccgcacggcgaaccggtgccgggtcgaccgggatggcgccgcgtcgccggcgac
gtcctcggtctctgggcgctcaacgtgccttggggcaccgagtccaccttagcggctcct
cacgcgaagtttgacgacggttccatcgacgtcgtcctggtgaacgtcaccaatcgcaag
aacatgctcaaacttttgctcgatttcgacgccggcgaccacgcgcgcaatcgcgccgtc
cgttacatcaaagccaaatccttcgaaatctaccccgccgccgccgccgccgccgccgcc
accgccgccgccatcgtcgacgcatcctcggagaccaacgccaccgctcccggcggcggc
ggttacatcgccgtcgacggcgaagtcctcgcctcgcggcggtttcgcgccgccgccgcc
gccgcgttcccgtacggtccgtttcgatgcgacgtcattcgcgccgcgtgcgccgtcttc
gcccctcctagcgcttaa

DBGET integrated database retrieval system