KEGG   Ostreococcus lucimarinus: OSTLU_17803Help
Entry
OSTLU_17803       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K10739  replication factor A2
Organism
olu  Ostreococcus lucimarinus
Pathway
olu03030  DNA replication
olu03420  Nucleotide excision repair
olu03430  Mismatch repair
olu03440  Homologous recombination
Module
olu_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:olu00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    OSTLU_17803
   03420 Nucleotide excision repair
    OSTLU_17803
   03430 Mismatch repair
    OSTLU_17803
   03440 Homologous recombination
    OSTLU_17803
DNA replication proteins [BR:olu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    OSTLU_17803
DNA repair and recombination proteins [BR:olu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     OSTLU_17803
   MMR (mismatch exicision repair)
     OSTLU_17803
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     OSTLU_17803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RPA_C tRNA_anti-codon RMI2 Stn1 CDC24_OB3 tRNA_anti_2 HTH_IclR
Motif
Other DBs
NCBI-GeneID: 5005037
NCBI-ProteinID: XP_001420928
JGI: 17803
UniProt: A4S6E3
Position
13:187058..187807
Genome map
AA seq 249 aa AA seqDB search
MTRRRPQDGSSEGKTYANVSAPPTMKPLTVKMLKRAIDARQTPDETLVVNGVPVHNLTVV
GKIVGVESKSSYVLYKVDDSTGVCDVKVWSDQDGDQTAEPIEVGAYVRVYGSVKTLANEH
MIAAHTQQAVRKITDHNEVTFHMLEVVYASGHAEKTKVSGGAAPANAYTVPQQAPNVAAN
GDLGSEEIDVSIMGVLKQFAEGEQGMTVDEIASKQNGKFTRDAIKAALEEMSNGGEVFTT
IDEDHYAAV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgacgtagaccgcaggatggatcgagcgaagggaagacgtacgcgaacgtgagc
gcgccgccgacgatgaaaccgttgacggttaagatgctgaagcgagcgatcgacgcgcga
cagacgccggatgaaacgctcgtggtgaatggggtgccggttcataacctgaccgtcgtc
ggtaagattgtgggcgtcgagagtaagagctcgtacgttttgtacaaggtggacgattcc
accggggtgtgcgacgtcaaggtgtggagtgaccaagacggcgatcagacggccgagccg
atcgaggttggcgcgtacgttcgtgtgtatggctcggtgaagactttggccaacgaacac
atgattgccgcgcacactcagcaggcggtgcgtaagattaccgaccacaacgaggtgacg
tttcacatgttggaagtcgtgtacgcgagcggccacgccgaaaagaccaaggtctcgggc
ggtgccgcgccggcgaacgcttacaccgtgccgcaacaagcgccgaacgtcgccgcgaat
ggtgatttgggctccgaggaaatcgacgtttcaattatgggcgtgctgaagcagttcgcc
gagggcgagcaagggatgaccgttgatgaaatcgcgtcgaagcaaaacggcaagtttact
cgcgatgccatcaaagctgcgctcgaagaaatgtcgaacggtggtgaggtgttcacgact
atcgacgaagaccactacgccgctgtgtaa

DBGET integrated database retrieval system