KEGG   Ostreococcus lucimarinus: OSTLU_17803Help
Entry
OSTLU_17803       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
olu  Ostreococcus lucimarinus
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:olu00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    OSTLU_17803
   03420 Nucleotide excision repair
    OSTLU_17803
   03430 Mismatch repair
    OSTLU_17803
   03440 Homologous recombination
    OSTLU_17803
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
13
AA seq 249 aa AA seqDB search
MTRRRPQDGSSEGKTYANVSAPPTMKPLTVKMLKRAIDARQTPDETLVVNGVPVHNLTVV
GKIVGVESKSSYVLYKVDDSTGVCDVKVWSDQDGDQTAEPIEVGAYVRVYGSVKTLANEH
MIAAHTQQAVRKITDHNEVTFHMLEVVYASGHAEKTKVSGGAAPANAYTVPQQAPNVAAN
GDLGSEEIDVSIMGVLKQFAEGEQGMTVDEIASKQNGKFTRDAIKAALEEMSNGGEVFTT
IDEDHYAAV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgacgtagaccgcaggatggatcgagcgaagggaagacgtacgcgaacgtgagc
gcgccgccgacgatgaaaccgttgacggttaagatgctgaagcgagcgatcgacgcgcga
cagacgccggatgaaacgctcgtggtgaatggggtgccggttcataacctgaccgtcgtc
ggtaagattgtgggcgtcgagagtaagagctcgtacgttttgtacaaggtggacgattcc
accggggtgtgcgacgtcaaggtgtggagtgaccaagacggcgatcagacggccgagccg
atcgaggttggcgcgtacgttcgtgtgtatggctcggtgaagactttggccaacgaacac
atgattgccgcgcacactcagcaggcggtgcgtaagattaccgaccacaacgaggtgacg
tttcacatgttggaagtcgtgtacgcgagcggccacgccgaaaagaccaaggtctcgggc
ggtgccgcgccggcgaacgcttacaccgtgccgcaacaagcgccgaacgtcgccgcgaat
ggtgatttgggctccgaggaaatcgacgtttcaattatgggcgtgctgaagcagttcgcc
gagggcgagcaagggatgaccgttgatgaaatcgcgtcgaagcaaaacggcaagtttact
cgcgatgccatcaaagctgcgctcgaagaaatgtcgaacggtggtgaggtgttcacgact
atcgacgaagaccactacgccgctgtgtaa

DBGET integrated database retrieval system