KEGG   Ostreococcus lucimarinus: OSTLU_19336Help
Entry
OSTLU_19336       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
olu  Ostreococcus lucimarinus
Brite
Protein kinases [BR:olu01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   OSTLU_19336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 2197 aa AA seqDB search
MMSLVLGRLVLHSGALTTEIVDSHVQRAIELLNADDGNQDVVSMKHYAAALTLTELARNA
PTIFNVHVPIFISSIWTALRDPSLRVREVAVLALRECLMVTERRETRYRVQWYYALYEAC
RAGLKQTSKVEEIHGSLLVFGELLRHTGEFMLSRYREVALTILRLQDFKKSIIRRTIVSL
IPKLAAFSPQRFAESYLVESCALILTTIRSPNDSGAGFQALSHLADAMSSVIDVDSDEVT
VGSSLLRGPNAYPEALECAGALMNSLHLAWKPHFVNLLMPMFTAGLSKSLVIGLESAAQG
APDLLPSIQLKLADAIASAIHQEPTTEKSCPMPPNKKIVQLALKTMRTFPFEPTVLLRSI
RKNVICYLDDSSAESRLEAALTCCSALRLRVGSSKSVTTAVENIMEALIPVAVGDNDASI
RNALLTEFCRPSASIDSYLSQAKSLRALFLTVNDESVAIRMLGIELLGRLATRNPAYVLP
ALRVHMLQLLAELEYSSESLHREESAKAAVLGTIGELANVSGYGITPFVQELLILLLIAL
KSASTRDHAVVTLGKLIESSGYVAEPFTTHPQLLPQLLRMLANERGIVRSEVLRTLGILG
ALDPHAHRGNEIRLHGEGVLSEEGVDDLGNNDDGDEELDILPMLHLTSLSDDYYPTIALN
SLLRVLRDPSRTSVRHMVVRSIVYIFQVLDTACVQYLPSVVPVMLSVIRTSDDSLREGMF
VELATLVGVIKAHIRRYLSDIFELMNIAWDRSGMSKNTLLLCEELSVALNDEFRRSLPMI
VPRIVSSLAEAERLRRYDSVPYILHALETFGTSLNDHLYLILPTLVRIFKPSVLDMPLDI
KRGALQSLRRLLPRMRLADQAGIVVHALTRVLDVEDVELRLDVLNVLISLEVSLGREYAL
FLPVVKRAVSKCGVKDPAFDDMVKRVESGNPLLFDDLESESLLIASATEHRKPVLQKHLS
VNQLAVRRAWESSQRSTKEDWLEWMRKLALDLLKSSPLPSLRACSELAQVQPNLARDLFC
ASFVSCWAELNESHREILVRSLEAALGSPTIPPEIVSVLLNLCEFMEHDEKPIPVDVRTL
GMIAERSRAYAKALHYKELEFITNPGACVAAIIAINNQLQLPEAARGVLVYAQENLTVDI
KESWYEKLEQWDDALEAYKRKLDELASVDSPQAMEERREAMVGQLRCLNALAEWEEIQRI
YEAGNQANVDWDEYRNDVTTIAAKAAWHLGDWEQMEILNTTDCDFYKSILAIRRGAQDEA
REHLAAAREMLGTELAALVRESYDRSYGALIRAQQLTELDEVIEYAQLTAVASPAAARRQ
EIIRKMWRDRIYLVKRDVEVWQELLQVRSLVLPMSEETDIWLKFASLNRKQGRDRQSRRT
LLRLLEYDPIMCAEGKPGFGAGSGRPKVMFAFVKHLWHTGQKRQAFMRLQSLAHELRVQL
ENMRASGQTETDHNKTVSRAFLKLGKWRWALTDSMNDETLTDVLMAFRTATSADQHWSKA
WHHWALFNATAMEHFHRQGGASTKDAMQHVAPAISGFFRSISLAGSSMKAKGGSLQDILR
LLTLWFNHGGSPEVETALIAGFGHVNIDTWLAVIPQIVARIHTHVLPVRNLIYQLLVRVG
RQHPQAVLYPLLVACKSQSTSRRAAAHAILDNVRQHSALLVEQAQIVSLELIRVAIVWHE
AWHEALEEASRLYFGEQNVEGMMAVLTPLHHILERQGAETLQEMGFVQNYGRELQEAHDL
CQKYRQSKREEELNQAWDLYYHVFKRITKQLPTMTTLELQYVSPRLLNSRDLELCVPGNY
ISGQVEQAQIRAFAPTMHVITSKQRPRRLQIHGSDGKDYGYLLKGHEDLRQDERVMQLFG
LVNTLLNTTMATAQRDLGIARYAVVPLSPNSGLIGWVPNCDTLHALIREYRDAHKVPLNL
EHRMMLAMAPDYDHLPLVNKVEIFQHAVENTSGGDLARVLWLKSRSSEQWLERRTTYTRS
LAVMSMVGYLLGLGDRHPSNLMVDRYSGKVLHIDFGDCFESSMYREKFPEKVPFRLTRML
VRAMEVSGIEGNFRSTCESVVTVLRDNKDSVMAMLEAFVHDPLINWRLLTNNVLAPDGES
MNTSAHDAQTSPAETPTPNRSRTSTYGIDDGTNDALNERAVSVMQRMSAKLTGRDGDHHH
VESMQPDSVEMQVERLISEATSAENLSVSYVGWCPWW
NT seq 6594 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcctggtcttaggtcgattggttttgcacagcggggcgttgacgactgaaatc
gtcgactcgcacgtgcagcgtgccatcgagttgttgaacgcggacgacgggaatcaagac
gtggtgagcatgaagcactacgccgcagctctgacgctgaccgaactcgcgcgcaatgcg
cctacgatcttcaacgtccacgtaccaatttttatctcgtccatctggaccgctttgcgc
gatccatctttgagagtgcgcgaagtcgctgtcttggcgcttcgcgagtgtctgatggtg
acggagcgccgagagacgagatatcgcgtgcagtggtactacgcgttgtacgaagcctgt
cgagcaggattgaagcaaacttcgaaagtagaagagatacacggttcattgttggtgttc
ggcgaattactgagacacactggcgagttcatgttgagtcgctatcgcgaagtggcgttg
acgattttgcggcttcaagattttaagaagtcaatcatacgacgaacgatcgtgagtttg
attcccaagttagcagcatttagtccacagcgcttcgcggagtcgtacctggtcgagtcg
tgtgcgttgatcctcacgacgattcgctcgccgaacgatagcggcgccggctttcaagcg
ctcagtcacctcgccgacgcaatgtcgtcagtgatagacgttgattcagatgaagtcaca
gttggcagctctttactgagaggaccgaacgcgtatccagaggcgctcgagtgcgccggg
gctttgatgaattcgctccacttagcgtggaagccgcatttcgtaaacttgttgatgcct
atgttcaccgcggggttgtccaagtcgctcgtcatagggcttgaatctgcagcccaaggt
gcaccggatctgttgccgtctatccaattgaaactggcagacgctattgcgagcgcgatt
catcaggaaccgacgacggagaagagctgcccgatgccaccgaacaaaaagatcgtgcaa
ctggcgctcaaaacgatgcgaactttcccgttcgaaccgacagtgttacttcgatcgatt
cgcaaaaatgtcatttgctacctggacgattcgtcagctgagtcacgactcgaagcggcg
ctgacgtgttgcagcgcgttgcgcctcagagtgggatcgagcaagagcgtgacgaccgcg
gtggagaacatcatggaagcgctcattccagtggcggtcggcgacaacgatgcatcgatc
agaaatgcgctgttgactgaattttgcaggccgagcgcatcgatagattcgtacctatcg
caggcaaaatctctcagggcgttgtttttgacagtgaacgacgagagtgttgccatacgc
atgttaggtattgagctgcttggacgcttggcgacgaggaatccggcgtacgtccttcca
gcactacgtgtgcacatgctgcagcttttagctgagctcgaatatagtagcgaatccctg
catagagaggagagtgccaaggcagcagtacttggcacgatcggcgagcttgcaaatgtt
agtggatatggcatcacgccatttgttcaagagcttctcattcttctattgatagcgctg
aaatcggcaagcactcgcgaccatgccgtcgtgactctcggcaagctcatcgagagctcg
ggatacgtcgctgagccgttcacgacgcacccgcagcttttgccacagttgctccgaatg
ctggcaaacgaacgcggtattgtcaggagcgaagtactgcggaccctgggaattcttggt
gcgctcgatccgcatgcgcacagaggaaatgaaattcgtttgcacggagagggtgtacta
agcgaagagggcgtcgatgatttaggcaataatgatgacggtgacgaagagctggatata
ctaccgatgcttcatttgacgtcgctatccgatgactattacccgacgatagcgctgaat
tcgttacttcgtgtgctgcgagatccttcgcgcacgagcgttcgtcacatggtggtgcga
agcatcgtgtacattttccaagtcctcgacacggcttgtgttcaatatttacctagcgtc
gtcccagtcatgctgagtgtgattcgaacgagtgatgatagcctgcgtgaaggaatgttt
gtggagctcgctactctggtgggtgtcatcaaggcacatattcgccgatacttgtcggac
atcttcgagctgatgaatattgcatgggatagaagcgggatgtccaaaaatacgctgctt
ttgtgcgaagagctttccgtcgctttgaacgacgagttcagaaggagtttacccatgatt
gttcctcgcatagtttcgtcgctcgcagaggctgagcgcttgcgcaggtacgattcagta
ccgtatattcttcacgccttggagacgttcggaacttcgctcaacgatcacctctacttg
atacttccgacgcttgtgcgcatttttaaaccaagcgttttggatatgccgcttgacatc
aaaagaggcgctctgcagtctctgcgcagactgctaccgcgcatgcgcttggcggaccag
gctgggattgtcgttcacgcgttgacgagagtattggacgtggaggacgtagagcttcgt
ttagatgtactaaacgtgctcatatcgttggaggtgtctcttgggcgcgaatatgcgctc
ttcttgcccgtcgtaaagcgtgctgtttcaaagtgcggcgtcaaggatccggcgtttgac
gacatggtcaagcgagtcgaaagtggtaatccgctactcttcgatgaccttgaatctgaa
tcgctattaatcgcgtcagccacggaacatagaaaacctgtgcttcaaaagcatctttca
gtgaaccaacttgccgttcgccgcgcttgggagagcagtcagcggtctaccaaggaagat
tggctagaatggatgcgaaaacttgcgttggatctgttgaagagctcaccactgccgtcg
ctacgagcgtgcagtgagttagcgcaagtgcagccgaatcttgctagggatctattttgc
gcttcgtttgtttcgtgctgggccgagctgaatgaaagccatcgagagattctagtgcgc
tcgctggaagccgctctcggaagcccgaccattcctcctgagatcgtctcagttttgctc
aatctctgcgagttcatggaacacgatgaaaagccaattccagttgacgtgcggacgttg
ggtatgattgctgaacgctccagagcttacgccaaagctttgcactacaaagaacttgag
ttcataacgaacccaggtgcgtgcgtcgcagccatcatcgccatcaacaaccagttgcaa
cttcccgaggcggctcgaggtgtgctcgtgtacgcgcaagaaaacttgacggtcgacatc
aaagagtcgtggtacgagaaacttgaacaatgggacgatgctttggaagcgtataaaaga
aaactggacgagctcgccagcgtggattcacctcaagcgatggaagaaagacgtgaagcg
atggtggggcagcttcgatgcttgaacgcactcgcggagtgggaagaaattcagagaatc
tacgaagctgggaatcaagcaaacgtcgattgggacgagtatcgcaacgatgttactacg
attgccgcgaaagctgcttggcatcttggagattgggagcagatggagattttgaacact
actgattgtgacttttacaagtccattctcgccatccgtcgaggcgcacaggacgaggcg
cgggagcatcttgccgccgcgcgcgagatgctcggcacggaactcgcggctctcgtgaga
gagtcttacgaccgttcttacggagcgctcatacgagcgcaacagctaactgagctggat
gaagtgattgaatacgcgcaactgactgcggtcgcttcacccgcggctgcgcggcgacaa
gagatcattcgaaaaatgtggcgcgatcgaatctacttggtcaagcgtgacgtcgaggtc
tggcaagagctcttgcaagttcgctcattggtgttgcccatgagcgaagaaactgatata
tggcttaagtttgcctctctgaaccgcaaacaagggcgcgaccgtcaatcacgtcgaacg
ttgttgcgcctccttgagtatgacccaatcatgtgtgccgagggcaagccaggattcggc
gcgggttctgggcgccctaaagtcatgtttgcgttcgtgaagcacttgtggcacacagga
cagaaaaggcaagcttttatgcgtcttcaatctctcgcacacgagttgcgagtgcaattg
gaaaacatgcgcgcttctggtcagacagagacggatcacaacaagacggtctcgcgagct
tttctcaaactcggcaaatggcgctgggcgctcaccgatagtatgaacgatgaaacactg
actgatgtgctcatggcgttcagaaccgcgacatctgcggaccagcattggtccaaggcg
tggcatcactgggcattgttcaacgccacggccatggaacatttccatcgccaaggtggt
gcgtcaacaaaggatgcgatgcagcacgtcgcgccagcaatcagtggatttttccgatca
atctctttggcaggctcatccatgaaagccaagggtggatcactgcaggacattctacgc
ctgctcacactttggttcaatcacggtggctcgcccgaagtcgaaacggccttgatcgct
gggtttggacacgtaaacatcgacacttggctcgccgtgatcccacaaatagttgcgcga
attcacacgcacgtcttacctgtgagaaatttgatttatcagcttctggtgcgtgttggc
cgacagcacccgcaggcggttctctatcctttgctcgtggcatgcaagagccagagtaca
tcgagacgagccgcggcgcacgcgattttggacaacgtgcgacagcacagcgccttactc
gtcgagcaagcacaaatcgtttctctcgagctcattcgagtcgcgatcgtgtggcatgag
gcctggcacgaggctttggaagaagcgtcacgtctatacttcggcgagcaaaacgtcgaa
ggtatgatggcagtattgactccattgcatcacatcttggaacgccagggtgctgaaact
cttcaagagatgggcttcgtgcaaaactacggccgcgagcttcaggaggcacacgacttg
tgtcaaaagtaccgccaaagtaagcgcgaagaagagctgaatcaagcgtgggacttgtac
tatcacgttttcaagcgtatcaccaaacagcttcctacaatgacgacattggaacttcag
tacgtgtcaccgcgtttgctcaattcgcgagatttagagctgtgcgttcccggcaactat
atatctggacaggtggaacaagcccagattagagccttcgcgccgactatgcacgtgatc
acgtccaagcagagaccgcgacgactgcaaattcatggatccgatggtaaagactatggt
tacctcctgaaaggtcatgaagatttgcgccaggacgaacgcgtgatgcaactcttcggt
ttggtgaacacgttgttgaacacgaccatggccacggcacaacgagacttgggcatcgct
cgctatgccgtcgtcccgctctccccgaacagcggtttgattggatgggtgcctaattgc
gacacccttcacgcgttgattcgtgagtacagagacgcgcacaaggtgccactgaatttg
gaacatcgcatgatgctcgccatggcgccggattacgatcatctacccctcgtgaataag
gttgagattttccaacacgccgttgaaaacacttcaggtggcgacttggcacgagtttta
tggttgaagagtcgaagtagtgagcaatggctcgagcgccggacgacgtacacgcgatct
ctcgccgtgatgtctatggtaggctacctactcggcctcggagatcgccacccatcaaac
ttgatggtggatcgatacagcggtaaggtgcttcacatcgactttggtgattgcttcgaa
tcgtcgatgtaccgagaaaagttccctgaaaaggtccctttccgactcactcgcatgctc
gtcagggcgatggaggtgagcggcatcgagggcaacttccgaagcacgtgcgagagcgtc
gtgacggttttgcgcgacaacaaagactctgtcatggcgatgttagaagccttcgtgcac
gatccgctcatcaactggcgtttgctgacgaacaatgttctcgccccagacggagaatcg
atgaatacatcagcgcacgacgcgcaaacaagcccggctgaaacgccgacgccgaatcgc
agccgcacgagcacgtacggcatcgatgacgggacaaacgatgcactgaatgaacgagcg
gtgagtgtcatgcaacgcatgagcgcgaaactcacaggtcgcgacggcgatcatcatcac
gtcgaatcgatgcaaccggattcagtcgagatgcaagtcgagcgattaatctctgaagct
acgagcgcagagaacctcagcgttagctacgtggggtggtgcccgtggtggtaa

DBGET integrated database retrieval system