KEGG   Ostreococcus lucimarinus: OSTLU_2171Help
Entry
OSTLU_2171        CDS       T01029                                 

Definition
hypothetical protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
olu  Ostreococcus lucimarinus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    OSTLU_2171
Enzymes [BR:olu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     OSTLU_2171
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     OSTLU_2171
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 468 aa AA seqDB search
VLALGSNQGDRVGLFRDAFAKLRRDLGFELHAHSSLYETAPAYVEDQGKFLNAACVGSFP
DDVARDPLALLDGLKAIEAALGRDFGTRRYGPRPMDLDVIFHGQGSHSCDRLTVPHARYA
ERPFVLAPLADLTGAATAATTSDATTEGLLEARRIWDGTDGEVTAMESGDIARVIPMRDR
LWSWGRETMVMGILNVTPDSFSDGGAYDGGVDVAVRHAREMVAAGATIIDVGGQSTRPGA
TRVSGEVESSRVIPVIRALAQAFSEREDVYISVDTFYGAVASAAADAGADIINDVSGGAW
DPAMLPTVARLEKPLPYVVMHVRGDPNSMQSAKNTTYDGHICDEVGDGLLATARRCVEYG
IEPWRLWIDPGIGFAKTGRANIELLRDLPRVRSRLAPLGGALMNAPMLVGASRKRFLGEI
SGRSEASERDAASVAALVAAVRGGADVVRVHNVALSADAARVADALWR
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgcgctcggatcgaatcaaggcgatcgcgtcgggttgtttcgcgacgcgttcgct
aaactcaggcgtgacctcggtttcgagcttcacgcgcattcctcgctctacgagaccgct
ccggcgtacgtcgaggaccaggggaagtttttgaacgccgcgtgcgtcggatcttttccc
gacgacgtcgcgcgagatccgctggcgctgctggatgggctgaaagccatcgaggcggcg
ctggggcgagacttcgggacgcggcggtacggaccgaggccgatggatttggacgtcata
ttccacgggcaaggctcgcattcgtgcgacagattgacggttccgcacgcgcgctacgcc
gagcggccgttcgtgctggcgccgctcgcagatttgacgggcgcagcgacggcggcgacg
acgagcgacgcgacgacggaagggctgctcgaggctcggaggatttgggacggcaccgat
ggagaggttacggcgatggaaagtggtgatatagcgcgcgtgatcccgatgagagacaga
ttgtggagctggggtcgagagacgatggtgatgggtattttgaacgtgacaccggattcg
tttagcgacggcggcgcgtacgacggcggcgtggacgtggctgtgcgacacgccagggaa
atggtcgccgcgggggcgacgataatagacgttggtgggcagtcgacgcgaccaggggcg
acgagggtgagtggagaagtagagagttcgcgggtgatccccgtcatacgcgcgctcgct
caagcgtttagcgaaagagaagacgtttacatctctgtagatacgttttatggcgccgtc
gcgagcgcggctgcggatgctggggctgacatcatcaacgatgtcagcggcggagcgtgg
gaccccgcgatgctaccgacggtggcgcgtttggagaagcctctgccgtacgtcgtcatg
catgttcgaggcgatccgaacagtatgcagagcgcgaagaacacgacgtacgatgggcac
atttgtgacgaggttggtgatggtctcttagcgaccgcacgtcgatgtgtggagtacggt
atagagccatggcgtctgtggattgatccgggcatcggtttcgcgaagacgggtcgagcc
aacatcgagctgttgcgagatttgccacgcgtccgaagccgcttagcccccttaggcgga
gcgctcatgaacgccccgatgctcgtgggtgcgtctcgcaaacgttttctcggtgagata
tcgggaaggtccgaagcgagcgagcgagacgccgcgtccgtggcagcgctcgtcgccgcc
gttagaggtggtgcggacgtcgtccgagttcataacgtcgcgctgtccgcggacgccgcg
cgagtagccgacgcgctgtggcga

DBGET integrated database retrieval system