KEGG   Ostreococcus lucimarinus: OSTLU_24166Help
Entry
OSTLU_24166       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
olu  Ostreococcus lucimarinus
Brite
Enzymes [BR:olu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     OSTLU_24166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 256 aa AA seqDB search
MITHASLLTAWFAVAVATFPFLFTATAPYGKFVRAGWGPFIDGNVGWATQEVVSPIAFWL
GHTRGDAIFDDLTHRTPASGYARALPWVFTAHYVYRALIYPATRRMSRTTAATVCAAVGF
NVINGVLIGAELAHGSAKPNDAQIIAGAAIMACGAALNIWYDTLLARLRAQRASGAYVVP
TGGLFNLVACPHYLGESIEWIGFAILTAPARSTAVFAFWTFANLFPRAVATRAYYRRRFG
ARAFPDRIRAMIPFIA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgatcacccacgcctcgctgctcaccgcttggttcgccgtcgcggtggcgacgttcccg
ttccttttcaccgcgacggcgccctacgggaagttcgttcgcgcgggatggggaccgttc
atcgacggcaacgtcggctgggcgacgcaagaggtcgtctcgcccatcgccttttggctc
gggcacacgcgcggtgacgccatcttcgacgatttgacccatcgcacgcccgctagtggg
tatgctcgagcgttaccgtgggtgttcaccgcgcattacgtctatcgcgcgttgatatat
cccgcgacgcgtcgcatgagtcgcaccacggcagccaccgtgtgcgccgccgtcggtttc
aacgtcatcaacggcgtgttaataggcgccgagctcgcgcacgggtcggcgaagccgaac
gacgcgcaaatcatcgccggcgcggccatcatggcgtgcggagcggcgttaaacatctgg
tacgacaccctcctcgcgcgactgcgcgctcagcgcgcgtccggcgcgtacgtcgtcccg
accggcggcctattcaatctcgtcgcctgtccgcactatctcggcgagtcgatcgagtgg
atcggtttcgcgattctcaccgcccccgcgagatccaccgcggtgttcgcgttttggacc
ttcgccaacctctttcctcgcgccgtcgccacgagggcgtactatcgccgccgcttcggc
gcgcgcgcgttccccgaccgcatccgcgccatgatccctttcatcgcctag

DBGET integrated database retrieval system