KEGG   Ostreococcus lucimarinus: OSTLU_24443Help
Entry
OSTLU_24443       CDS       T01029                                 

Gene name
HAC3501
Definition
hypothetical protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
olu  Ostreococcus lucimarinus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 1100 aa AA seqDB search
MISRQGAQQGGRGGGSAAAASRQQMGALFPGGLGGNMAQPAAGQMMGGNGMLPNGAPILR
GAAAAQGSQYAGGSSQMMAGVPPGTMIPTQGVGSMMPEAATAAAPKGRAKAPPKGKKLTK
AQQAAQAKQLAQQQQMAQQQQAAMRGRQQPGSGGGGVVANWRDINDEQLRKAYIVKQQRW
LLFLRHASKCQARHGHCPYTPHCHVAKQLWEHVLKCTLTQCNYPRCLASRELLKHHQTCK
DAGCPVCGPVRNAMLKQRQQAQMQMAHGNKRMKLDHDLDRGQLMVKGTSGLKTDRKPGGE
GTSLMECFTPEEIRTHLAALRLADKEKVQGQGQPSARQLQKEAERAVINATESSCRACGV
ERLTFEPPPLYCYSCVGRIKRGQVFHQMPSLGGETRRDAWCNPCFNAIQGYVDVEGQRFP
KATLIKKKNDDDLEEPWVQCDYCEDWYHQLCVLFNGRRNEGGEAPFTCPNCILSQLDKNE
RQVTAERPSSQQPASSLPKTKMSTFLEERLASKLSAERVERAKQLGVPIENVPTAENLTI
RVVSQTLKQMDTKPHYYAHFKEQGIPAHFTYRSRVILLFQKLEATDVCLMAIYVQEYDDE
CPEPNRRRIYLSYLDSVKYFRPDNVTVATGENCALRTYVYHNILIAYLDYVKQRGFTSCF
IWACPPFQGDDYILYCHPKVQKTPKADKLREWYLKMLRSAQKDGIVISTSNVYDEFRLGN
QNHDIRCATEYPYFDGDYFSGIAEDWIPTIMKELEEAKNIEAKTKSSTVKISARKAAKAK
SGTIAADAELNKELMKKLGTTISNMRNDFMLAHLAHQCLCCRRTIAGANRYYATEGTPLV
LCEECKETEDAMPENEKRYAGRKLECEKCEEIPTLTKEQKDEEEKLESEFFDTRQAFLSL
CQGNHFQFDSLRRAKHTTMMVLYHLNNPSEPAFVASCNVCSRELEPGKGWRCETCPDFDI
CDNCRIRTGHQHPLMRQGRTAGDRTALSQAERENRAAQIERTMELLLHACKCRKERCENS
NCPKIKHLLKHALSCTVKSAGGCQLCRKTWTLLQIHSKGCMEDDCPVPRCRDLKEYRRRG
QEQIEERRREQYRLYLNAAR
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atgatttctcgtcaaggcgcgcaacagggcggaagaggaggcgggagcgctgcggcggct
tcgcgtcagcagatgggagcgttgttcccagggggattaggggggaatatggcgcaaccc
gcggcgggacagatgatggggggtaacggtatgttaccgaatggggcgccgattttgcgc
ggcgcggcggcggcgcaaggatcgcaatacgcgggaggatcttcgcaaatgatggccggc
gtgccacctgggacgatgattccgacgcagggtgtgggttcgatgatgcctgaggcagcg
acggcggcggcgcccaagggacgagctaaggcgccgccgaagggtaaaaagctcaccaag
gcgcagcaggcggcgcaggcgaagcagctcgcgcaacagcaacagatggcccaacagcaa
caggcggcgatgcgcgggcgccagcaaccgggtagtggtgggggtggtgtcgttgctaat
tggcgagacatcaatgacgagcagttacgaaaggcgtacatcgtgaaacagcaacgatgg
cttctcttccttcgacacgcgagcaagtgtcaggcgcgacacgggcactgcccctacacg
ccgcactgtcacgtcgcgaagcagttgtgggagcacgtgttgaagtgtacgctgacgcag
tgcaactatcctcgatgtttggcgtcgcgtgagttgttgaagcatcatcagacgtgcaag
gacgctgggtgtccggtgtgcggtcccgtgcgcaacgccatgctcaagcagcgtcaacag
gcgcaaatgcaaatggcgcacggcaacaagagaatgaagctcgatcacgatctcgatcgt
ggtcaactcatggtgaagggtacgagcggtttgaaaacggatcgcaagccaggtggcgaa
gggacgtcgttaatggagtgcttcactccggaagaaatccgtacgcatctcgccgccttg
cgtctcgccgacaaggaaaaggtgcaaggtcaaggtcaaccgagcgctcgtcagcttcag
aaggaagctgagcgggcggtgatcaacgcgacagaaagttcgtgccgtgcatgcggcgtt
gaacgattgacgttcgaaccaccgccgctttactgctacagttgcgtcggtcgcatcaag
cgcggacaagtattccaccagatgcctagcctcgggggcgagactcgaagagatgcgtgg
tgtaacccgtgcttcaacgccatccaagggtatgtcgatgtcgagggtcaacggtttccg
aaagcgacgctcatcaagaagaagaacgacgacgatctcgaggagccatgggtgcaatgc
gactactgcgaggattggtatcaccaactctgcgttcttttcaacggtagacgcaatgaa
ggcggtgaagcgccattcacgtgtccaaactgcatcttatcgcagttggataagaacgaa
cgtcaagttactgctgaacgtccgtcttcacaacagccggcgagctcgttaccgaagaca
aagatgtcgacgtttttggaagaacgcctcgcgtcgaagctctcggcggaacgcgtggag
cgcgcgaagcagttgggcgtacccatagaaaacgtcccgaccgctgagaacttgaccatt
cgtgttgtgtctcaaacactcaaacaaatggacaccaagccgcactactacgcccacttc
aaagaacagggcattccggcgcactttacttaccgttcgcgcgtcatcctcctgttccaa
aagcttgaggccaccgatgtgtgtttgatggctatttatgtgcaagagtatgatgacgag
tgccctgaaccgaaccggcgaagaatttacctctcgtatttggactctgtcaagtacttc
cgaccggacaacgtcaccgtggccacgggcgaaaactgcgcgttgcgcacgtacgtctat
cacaacattctgattgcgtacctggactatgtcaaacagcgcggcttcacgtcgtgcttt
atttgggcgtgtccgccgttccaaggagacgattacattctgtactgtcaccccaaggtg
caaaagacgccaaaggctgacaagcttcgtgagtggtacctcaagatgttgcgctcggcg
cagaaggatggcatcgtcatttcaacttcgaacgtgtacgatgaattccgactcggcaat
caaaatcacgatattcgatgcgccactgagtatccgtatttcgatggtgattacttctcc
ggcattgcggaagattggataccgaccatcatgaaggaactcgaggaggcaaagaacatc
gaggcgaagacaaagtcgtccacggttaagatcagcgcgcgcaaggcggccaaggcaaag
agtggcacgatcgccgctgacgctgaactgaataaagaactaatgaagaagctcgggacg
acgatcagcaacatgagaaacgacttcatgctcgcccatcttgcgcaccaatgtttgtgc
tgccgcagaaccatcgccggtgccaaccgctattacgcgacggaaggcacacccttggtg
ctttgcgaagaatgcaaggagactgaagatgcgatgccagagaacgaaaaacgttacgct
ggccgcaagctcgagtgcgaaaagtgtgaggaaattcccacgctgacgaaggaacagaag
gacgaggaggaaaagctcgagagcgaattctttgacacacgtcaagcgttcctgtccttg
tgccaaggcaatcacttccagttcgactcgcttcgtcgcgccaaacatacgaccatgatg
gtgctgtatcacttgaacaatccatctgagcctgcattcgtcgcatcatgcaacgtttgt
tcacgcgagctcgagcccggaaagggttggcgctgcgagacgtgccccgatttcgatatt
tgcgacaactgccgcatcagaactggtcaccagcaccccctcatgcgacaaggtcgtacc
gccggagatcgcacggcgttgtctcaagccgagcgcgagaaccgcgcggcgcagatcgag
cgaaccatggaactcttgctccacgcgtgcaaatgccgcaaagaacgatgcgaaaacagc
aactgcccgaaaatcaaacacttgctcaagcacgccttgagctgcacggtcaaatcagca
ggcgggtgccagctctgccgtaaaacgtggacgctgttgcaaattcattctaagggatgc
atggaggacgactgccccgtgcccaggtgccgcgatctcaaagagtaccgtcgtcgcggt
caagaacaaattgaagagcgccgacgcgagcaatacagactttacctgaacgccgcgcga
tga

DBGET integrated database retrieval system