KEGG   Ostreococcus lucimarinus: OSTLU_2484Help
Entry
OSTLU_2484        CDS       T01029                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
olu  Ostreococcus lucimarinus
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:olu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    OSTLU_2484
Enzymes [BR:olu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     OSTLU_2484
Exosome [BR:olu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   OSTLU_2484
  Exosomal proteins of colorectal cancer cells
   OSTLU_2484
  Exosomal proteins of bladder cancer cells
   OSTLU_2484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 443 aa AA seqDB search
EAPTDDHVLKLDASIFDNELKKSKYNFVMFYAPWDGHSKAFMPRWMSYAQSHKMAGTEMT
FSLVDATKERDLDKRFEIEEYPTLILFRDGVPKRYVGDRSPQHLDKFVRRNLLKPARWLE
GTDDVEVFLMGRDVTVIGFFDNKDDLDVYHHAAAEFDLDFGETKSKIATEDWKAPFPTIK
MWRDFDKEPVRYPGDVRDLDAIKSWIATEMVPPIVKFENKKQLERLFMGPIAANIFVFLP
EDATEAEKMSKSLESAARQLRGKVHIITVDAKETVMHDYFSLRESDGPTIRLLSHDLKYQ
YKGSLEAAEISNDVVHFFKEFEAKKLVPLLKSQDPLPKDGDVLQVVGKTFQSLLMDNDKH
VFVWFYAPWCRTCKAMKPVWDKLATLYKDEKDIIIAKMDATKNEAKDLHVRHYPTVYYYH
SGDKPRHEEYDGHMETDAFTDFL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
gaagcgccgacggatgatcacgtgttgaagctcgatgcgagcatcttcgacaacgagttg
aaaaagtcgaaatataacttcgtgatgttttacgcgccgtgggatgggcactcaaaggcg
ttcatgccgcgttggatgtcttacgcgcagtcgcataaaatggcgggcacggagatgacg
ttttcgctcgtggacgcgaccaaggaacgcgatttggataagcgattcgaaatcgaggaa
tacccgacgctcatattgttccgtgatggtgtgccgaagaggtacgtgggcgatcgatcg
ccgcaacacttggataagtttgttcgaagaaacttgctcaagccggcgcgttggctggaa
ggcacggacgacgtcgaagttttcttgatgggtcgcgacgtcaccgttatcgggttcttc
gataacaaggatgatttggacgtgtaccaccacgccgcggctgagtttgatctcgacttt
ggcgagacgaagagcaaaatcgccactgaagactggaaagcgccgttcccgaccatcaag
atgtggcgcgactttgacaaagaacccgttaggtaccccggcgacgtgcgcgatttggat
gctatcaagtcctggatcgccactgaaatggtcccaccgatcgtgaagttcgaaaacaag
aagcaactcgagcgccttttcatgggtccgatcgctgcgaacatcttcgtattcttaccc
gaagacgcgaccgaagccgagaagatgtcgaaatctttagaaagtgcggccagacaactt
cgtggtaaggtgcacatcatcaccgtcgatgccaaagaaactgtcatgcatgactacttc
tctctccgcgagagcgacgggccgacgattcgccttctctcgcatgacttgaagtatcaa
tacaagggctcattggaggccgccgagatctcaaacgatgtcgtgcactttttcaaggaa
ttcgaggcgaaaaagctcgtgccgttgctcaagtcgcaagatccgctccccaaggacggt
gacgttctgcaagttgtcggtaagacgttccagtcgttgctcatggataacgacaagcac
gtctttgtttggttctacgcgccgtggtgccgcacgtgcaaggcgatgaagccggtgtgg
gataagctcgccacgctttacaaggatgagaaagacatcatcatcgccaagatggatgcg
acgaagaacgaggcgaaggatttgcacgttcgacactatccgaccgtgtactactatcat
tccggtgataagcccagacacgaggaatacgacggacacatggaaacggatgcgttcacc
gatttcctc

DBGET integrated database retrieval system