KEGG   Ostreococcus lucimarinus: OSTLU_24989Help
Entry
OSTLU_24989       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
olu  Ostreococcus lucimarinus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:olu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:olu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:olu00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:olu00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:olu00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:olu00710]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 279 aa AA seqDB search
MLPRCWVVASRVHAAAQRRSVVVNAGTGKFIVGGNWKCNGTAESVKSLVKELNSGKIDAD
VDVYVAPPFVFIPRVQKELNNKNYAVAAQNCWVSAGGAFTGEVSADMLADADIPWVILGH
SERRALCGETNEFVGEKTKYALSKGLKVALCIGETLEQREAGTTLDICRAQLKAVNDVVT
AADWENIVIAYEPVWAIGTGKVATPDQAQEVHAGIRKWCADNISPAIASKIRIQYGGSVN
AGNCDELAQKEDIDGFLVGGASLIGEAFVTICNSAKHSK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgcggtgttgggttgtggcatcgcgggtgcacgccgcagcgcagcgacgaagc
gtcgtcgtgaatgcgggcacgggtaaatttatcgtcggcgggaactggaagtgcaacggc
acggcggagtccgtcaagtcgctcgtgaaggaactaaactctgggaaaatcgacgccgac
gttgacgtctacgtcgcgcctccgttcgtcttcattcctcgagtgcaaaaggagctcaac
aacaaaaactacgccgtcgccgcgcagaactgttgggtctccgcgggtggggcgttcacg
ggtgaggtgagcgcggatatgctcgccgacgccgacattccgtgggtgattctcgggcac
agcgaacgccgcgcgctctgcggcgagacgaacgagttcgtcggggagaagaccaaatat
gccttgagcaagggattgaaggttgctttgtgcatcggtgagacgttggaacagcgcgaa
gcgggcacgactctggatatttgccgcgcgcaactcaaggcggtgaacgacgtcgtgacc
gcggcggactgggaaaacatcgtcatcgcgtacgagcccgtttgggcgatcggtaccggc
aaggtcgcgacgccggaccaagcgcaagaagtgcacgcgggcattcgcaagtggtgcgcg
gataatatttctccggcgattgcgtcgaagattcgcattcagtacggcggcagcgtcaac
gccggcaactgcgacgaattagctcagaaagaggacattgacggctttctcgtcggcggc
gcgtctttgatcggcgaggctttcgtgacgatttgcaacagcgccaagcactctaagtga

DBGET integrated database retrieval system