KEGG   Ostreococcus lucimarinus: OSTLU_26163Help
Entry
OSTLU_26163       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
olu  Ostreococcus lucimarinus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    OSTLU_26163
Enzymes [BR:olu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     OSTLU_26163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 433 aa AA seqDB search
MRRPDARTTSLRIGFGSCNKQSLDMTLLWPDVAREEYDAFAWIGDAVYADERVKLANGER
TRRYLGEKAHEEAYERVKRDEAYAAVRRRADVVGTWDDHDYGFNNAGKHWSRKAFAKKAF
LDFLDEPVGSERRTREGGVWDSVDYVDEASGRRARVILLDLRWDLEEPDEVSEGKMMSET
QWAWFETQLAAEPKPEVTIVGSGIQVIEAPHLMLRPLAPYVEPARLVAEGLESWSRVPRE
QSRLFDTIKRTGARVVFMSGDVHHGQIAAAAPGCYLPYKTIDITSSGFTHTPFRDAKPWP
LALFLRLATPKYFRQWILPSYTRWTDINYGEIEIDWARGAVFARIKSVGGKVALEESVTF
AELDENVPDLGFDRAGCNLTLEMSPKMRAFRIVVFFTWLAGVYAFKFLAPIFVAAYAVRK
ARRYARARGLKQD
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgaccggacgcgcgaacgacgtcgctcaggatcggattcgggtcgtgcaacaaa
caatcgctggacatgacgctgctgtggccggacgtcgcgcgcgaggaatacgacgcgttc
gcgtggatcggagacgcggtgtacgcggacgaacgggtgaaactggcgaatggggaacgg
acgcgacggtatttgggggagaaagcgcacgaggaggcgtacgagagggtgaagagggac
gaggcgtacgcggcggtgcggaggcgagcggacgtcgtcgggacgtgggatgatcacgat
tatgggtttaataacgcggggaaacactggtcgcgcaaggcgttcgcgaagaaggcgttt
ttggacttcttggacgaaccggtcgggagcgagcggcgcacgcgcgagggcggggtgtgg
gactcggtggattacgtggacgaggcgagcgggcgacgagcgcgggtgattttgttggat
ttgcgttgggatttggaagaaccggacgaggtgagcgaggggaagatgatgagcgagacg
cagtgggcgtggttcgaaacgcagctcgcggcggaaccgaaacccgaggtgacgatcgtg
gggagtgggattcaagtcatagaggcgccgcacttgatgttgcggccgctggcgccgtac
gtcgagccggctcgactcgtcgccgaaggcttagagagttggtcgcgcgttcctcgcgag
caatcgagattgtttgatacgatcaaacgaacgggtgcgcgcgtggttttcatgtccggc
gacgtgcaccacggacaaatcgccgcggcggcgccgggatgttacctgccgtacaaaacc
atcgacatcacctcgagcgggttcacgcacaccccgttcagggacgcgaagccgtggccg
ttggctctgttcttgcgcctcgcgacgccgaagtactttcgtcaatggattctcccctcg
tacacgcgttggacggacatcaactacggcgaaatcgaaatcgattgggcgcgaggcgcc
gtcttcgctcgcatcaagagcgtcggcggcaaagtcgcgctcgaagaatccgtgacgttc
gccgagctcgatgaaaacgtcccagatctcgggttcgatcgtgctggatgcaacttgacg
ctcgaaatgagtccaaaaatgcgcgcctttcgcatcgtcgtcttcttcacctggctcgcg
ggcgtgtacgcgttcaaattcttggcgccgattttcgtcgccgcgtacgcggtccggaaa
gcgcgaagatacgcgcgcgcgcgcggcttgaagcaagattga

DBGET integrated database retrieval system