KEGG   Ostreococcus lucimarinus: OSTLU_26180Help
Entry
OSTLU_26180       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
olu  Ostreococcus lucimarinus
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:olu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    OSTLU_26180
Translation factors [BR:olu03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    OSTLU_26180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 234 aa AA seqDB search
MSDDDAGWDDDDYEVPDLTRVGIRAAATEDKFADEDAETAEEVAAREAKARADAQARAAQ
SARTKAKAAVKTRVAYDDDALDDPVAEKARRQRLVEEADLRAARELFGDAEVKLDEFEPK
SKGEFEKFGSAIAYKYLTSRSESGFYTAGLKALLRVAMRDLTAAEAKDVETQVVATRTEK
VKKEKSDAEAAKKLASGSKKGKGKFLNAGSKGGDSGLDDYKYDVASPDDDYDFM
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgacgacgccgggtgggacgacgacgactacgaggtccccgacctgacgcgc
gtcggaatcagagcagccgcgaccgaggacaagttcgcggacgaggacgcggagacggcg
gaggaggtcgcggcgcgcgaggcgaaggcgagggcggacgcccaggcgcgcgcggcgcag
agcgcgcggacgaaggcgaaggcggcggtgaagacgcgcgtggcgtacgacgacgacgcg
ctggacgatccggtggcggagaaggcgcgacgacagcggttggtggaggaggcggatttg
agggcggcgcgcgagctcttcggcgacgcggaggtgaagttggacgagttcgaaccgaag
agtaagggggagtttgagaagtttgggagcgcgatcgcgtataaatacttgacgtcgagg
agtgagagtgggttttacaccgcggggttgaaggcgctgttgagagtggcgatgcgggac
ttgacggcggcggaggcgaaggacgtggagacgcaggtggtggcgacgcgcacggaaaag
gtgaagaaggagaagtccgacgccgaggcggcgaaaaaactcgcgagtgggtcgaagaag
ggtaagggcaaattcttgaacgccgggtccaagggcggggactcgggcttggacgattac
aagtacgacgtcgcgagtccggacgacgattacgatttcatgtga

DBGET integrated database retrieval system