KEGG   Ostreococcus lucimarinus: OSTLU_26674Help
Entry
OSTLU_26674       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
olu  Ostreococcus lucimarinus
Brite
Enzymes [BR:olu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     OSTLU_26674
    1.3.1.94  polyprenol reductase
     OSTLU_26674
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
12
AA seq 327 aa AA seqDB search
MWDWDDDSTANVALALTWLALVTCSALVAARRDVEAARGAAARGKDGKGLKRGRAPHAWF
RHFYVVGCAANARELARLWARGAATGRADARAAVVAATLFQAHCLRRLYESARVSTYGDD
ATMHAIVYAGGLAYYVCAPKTWAAYDCGDAAKTTLEPLETLAATALGALGVALFALGNYR
QYECHVILARLREPSAPSSSARDADADVARRSRYFIPRGGWFERVSCAHYLAEIVLYLGL
ALIVVPTDVFLGKLSVSARPSVSSVSRASSSSAVVAARVPRLAPLALLAAVVANLACVAS
SHHAWYLKTFGDAYPRDRGALFPRRRG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtgggactgggacgatgactcgacggcgaacgtcgcgctcgcgctgacgtggctcgcg
ctcgtgacgtgcagcgcgctcgtcgcggcgcgacgggacgtcgaggcggcgcgcggcgcg
gcggcgcgaggcaaggacgggaagggactgaagcgcggacgagcgccgcacgcgtggttt
cgacacttttacgtcgtcgggtgcgcggcgaacgcgcgcgagctggcgaggctgtgggcg
agaggcgcggcgacgggacgggcggacgcgcgcgcggcggtcgtcgcggcgacgctgttt
caggcgcactgtttgaggagattgtacgagagcgcgcgcgtgagcacgtacggagacgac
gcgacgatgcacgcgatcgtgtacgcgggcgggttggcgtattacgtgtgcgcgccgaag
acgtgggcggcgtacgactgcggcgacgcggcgaagacgacgctcgagccgctcgagacg
ctcgcggcgacggcgctcggcgcgctcggcgtcgcgctgttcgcgctcggaaattatcgg
cagtacgagtgtcacgtcatactcgcgcgtttgcgcgaaccgagcgcgccgtcctcgagc
gcgcgcgacgccgacgccgacgtcgcgcgccgctcgcgatactttatcccgcgcggcggt
tggttcgagcgcgtctcctgcgcgcactacctcgccgagatcgtcctttacctcggtctc
gcgctcatcgtcgttcccaccgacgtcttcctcggcaagctctccgtctccgcgcgtccg
tcggtgtcgtcggtatcgcgcgcgtcgtcgtcgtccgccgtcgtcgccgcgcgcgtcccg
cgtctcgccccgctcgccctgctcgccgccgtcgtcgccaacctcgcgtgcgtcgcgtct
tcgcaccacgcgtggtatttaaaaaccttcggcgacgcgtacccgcgcgatcgaggcgcg
ctgttcccgcgtcggcgcggatag

DBGET integrated database retrieval system