KEGG   Ostreococcus lucimarinus: OSTLU_27323Help
Entry
OSTLU_27323       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
olu  Ostreococcus lucimarinus
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:olu03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
14
AA seq 324 aa AA seqDB search
MTTTLDVDSVIERLLSVRGQPNNRTVQLAEGEIRALCAAAREIFLAQPCLLELEAPLKIC
GDVHGQYSDLLRLFEYGGFPPEANYLFLGDYVDRGKQGLEVICLLLAYKVKYPENFFLLR
GNHECNSISRIYGFYDECKRRYNIKLWRVFCDVFNCLPFAAIVDEKIFCIHGGPSPELKD
LQQIVQIKRPTDIPDMGMLCDFLWSDPDADIQGWGENDRGVSYTYGTDVVGDFLHKFDFD
LVVRAHQVVENGYEFFGKRQLVTVFSAPNYCGEFDNAGAMMTVDENLMCSFQILKPAERK
LMGGFGSMMGARPSTPPRTGGAKT
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgacgctggacgtcgacagcgtcatcgaacggttgctgagcgtgcgaggacaa
ccgaataatcgaacggtgcagctcgcggagggagagatcagggcgctgtgcgcggcggcg
agagaaattttcctggcgcagccgtgcttgttggagctcgaggcgccgttgaagatttgt
ggtgacgttcacggacagtactcagacttgttgcgattgttcgagtacggtgggtttccg
ccggaggcgaactatctgttcttgggggattacgtcgatcgcggcaagcaaggcttggag
gtgatttgtttgctcctggcgtacaaggtgaagtacccggaaaactttttcctactcaga
ggtaaccacgagtgcaactcgatcagtcggatttacgggttctacgacgagtgcaagagg
cgctacaacataaagctgtggcgcgtgttttgcgacgtctttaactgtctgccgttcgcc
gccatcgtggatgagaagatcttttgcattcacggtggaccgagcccggagttgaaggac
ttgcagcagatagttcaaatcaagcggccgacggatattcccgacatgggaatgctttgt
gactttttatggagcgatccggatgcggatatacaaggctggggcgaaaacgaccgcggc
gtgtcgtacacttacggtaccgacgtcgtcggcgatttcctccacaagtttgattttgac
ttagttgttagagcacatcaggtggttgagaacggttacgagtttttcggaaagcgtcaa
ctcgtcacggtgttctcggcgccgaattactgcggggagtttgacaacgccggcgcgatg
atgacggtggatgaaaacttaatgtgcagcttccagatattaaagcctgcggagcgcaaa
ctcatgggtggttttgggagtatgatgggcgcgcgtccttccacgcctcctcgaacaggc
ggcgcgaagacgtaa

DBGET integrated database retrieval system