KEGG   Ostreococcus lucimarinus: OSTLU_27329Help
Entry
OSTLU_27329       CDS       T01029                                 

Gene name
HAG3503
Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
olu  Ostreococcus lucimarinus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
14
AA seq 555 aa AA seqDB search
MARDRPADVAGRSESERKVLAIADIVAQLVARDASDGFMNLNSVKNATSRKYKLSKAPKL
TELIAAVPVEHRDQLLPKLRAKPVRTASGVAVVAVMSKPHRCPHIATTGNVCVYCPGGPD
SDFEYSTQSYTGYEPTSMRAIRARYDPYAQSRGRVDQLRRLGHAVDKVEFVLMGGTFMSL
PIDYRDFFIRNLHDSLSGASSSCVDEAVKASEQSRTKCVGLTIETRPDYCQSPHLRQMLS
YGCTRLEIGLQSIYEDVARDTNRGHTVAAVQKCFELAKDAGFKVIAHMMPDLPNVGMERD
LESFREFFESPDFRTDGLKLYPTLVIRGTGLYELWRTGKYRNYHPERLVDLVARVLALVP
PWVRVYRVQRDIPMPLVTAGVEKGNLRELAMARMADLGLRCRDVRTREVGLQDIHNRVAP
THVELVRRDYVANGGWETFLSYEDPRQDILVGLLRLRKCGRTAAKTSPALKGKCSMVREL
HVYGTAVAVHSRHKGRFQHRGYGTLLMREAERIAREEHGSSKLAVISGVGTRHYYRKLGY
ELEETYMVKHLSANE
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgatcgccccgcggacgtcgccgggcgcagcgagagcgagcgtaaggtgctg
gcgatcgcggacatcgtcgcgcagctcgtcgcgcgcgacgcgagcgatggattcatgaac
ttgaactcggtcaaaaacgcgacgagccgcaagtacaagctttcgaaggcgccgaagctc
accgaactcatcgcggcggtgccggtggaacatcgcgatcagttgctgccgaaactcagg
gcgaaaccggtgcgaacggcgagcggggtggcggtggtggcggtgatgagtaaaccgcat
cggtgcccgcacatagcgacgacgggcaacgtgtgcgtgtactgcccgggaggacccgat
agtgattttgagtactccacgcagtcttacactggatatgaaccgacgtcgatgcgagcg
atacgggcgaggtacgatccgtacgcgcagtctcgaggacgggtggaccagttgcgacgg
ctgggacacgcggtggacaaggtggagttcgtgctcatgggagggacgttcatgtcgctg
ccgatcgattatagagattttttcatcagaaatttgcacgattcgctcagtggggcgagc
tcgtcgtgcgtggatgaggctgtgaaggcgtcggagcagagtaggacgaagtgcgtgggg
ttgacgattgagacgcggccggattattgtcagtcaccgcatttgcgacagatgttgtcg
tacgggtgcacgcgattggaaatcggtttgcagagcatctatgaagacgtcgcgcgcgac
accaatcgtgggcacaccgtggcggcggtgcaaaagtgttttgaattagccaaagacgcg
ggatttaaagtcatcgcgcacatgatgccggatttgccaaacgtgggcatggagcgcgat
ttggagtcgtttcgagaatttttcgagtcgcctgattttagaacagatggcttgaagctt
tatcctacgctcgtcattcgaggtacaggattgtacgagttgtggcgcaccggcaagtat
agaaattaccaccccgagcgcttggtggatttagtcgcgcgagtgctcgcgctcgtccca
ccctgggtccgggtctatcgcgtccagcgcgatattcccatgcctctcgtcaccgcgggc
gtggagaagggtaaccttcgtgagctcgcgatggcgcgcatggcggatctaggcttaaga
tgtcgcgacgtgcgcacgcgcgaagtcggcttacaagatattcataaccgcgtcgctccg
acgcacgttgaactcgtccgtcgcgactacgtcgccaatggcgggtgggagacattctta
tcttacgaagatccgcgacaagacatcttggtaggactcttgcgtcttcgcaagtgcggt
cgaacggccgccaagacgtcgcctgcgctcaagggcaaatgttccatggttcgcgagctt
cacgtctacggcaccgccgtcgccgtgcactcgcgacacaagggtcgctttcaacaccgc
gggtatggcactttactcatgcgcgaggccgagcgcatcgctcgcgaagaacacggctcg
agcaagctcgccgtgatttccggcgtcggcacgcgacactactatcgcaagctcggatac
gaattagaagaaacctacatggtgaagcatctctccgcgaacgagtag

DBGET integrated database retrieval system