KEGG   Ostreococcus lucimarinus: OSTLU_27329Help
Entry
OSTLU_27329       CDS       T01029                                 

Gene name
HAG3503
Definition
(RefSeq) predicted protein
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
olu  Ostreococcus lucimarinus
Brite
Enzymes [BR:olu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     OSTLU_27329 (HAG3503)
Transfer RNA biogenesis [BR:olu03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    OSTLU_27329 (HAG3503)
Chromosome [BR:olu03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    OSTLU_27329 (HAG3503)
   HAT complexes
    Elongator complex
     OSTLU_27329 (HAG3503)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 FR47 Acetyltransf_9
Motif
Other DBs
NCBI-GeneID: 5005385
NCBI-ProteinID: XP_001421200
JGI: 27329
UniProt: A4S727
Position
14:75428..77095
Genome map
AA seq 555 aa AA seqDB search
MARDRPADVAGRSESERKVLAIADIVAQLVARDASDGFMNLNSVKNATSRKYKLSKAPKL
TELIAAVPVEHRDQLLPKLRAKPVRTASGVAVVAVMSKPHRCPHIATTGNVCVYCPGGPD
SDFEYSTQSYTGYEPTSMRAIRARYDPYAQSRGRVDQLRRLGHAVDKVEFVLMGGTFMSL
PIDYRDFFIRNLHDSLSGASSSCVDEAVKASEQSRTKCVGLTIETRPDYCQSPHLRQMLS
YGCTRLEIGLQSIYEDVARDTNRGHTVAAVQKCFELAKDAGFKVIAHMMPDLPNVGMERD
LESFREFFESPDFRTDGLKLYPTLVIRGTGLYELWRTGKYRNYHPERLVDLVARVLALVP
PWVRVYRVQRDIPMPLVTAGVEKGNLRELAMARMADLGLRCRDVRTREVGLQDIHNRVAP
THVELVRRDYVANGGWETFLSYEDPRQDILVGLLRLRKCGRTAAKTSPALKGKCSMVREL
HVYGTAVAVHSRHKGRFQHRGYGTLLMREAERIAREEHGSSKLAVISGVGTRHYYRKLGY
ELEETYMVKHLSANE
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgatcgccccgcggacgtcgccgggcgcagcgagagcgagcgtaaggtgctg
gcgatcgcggacatcgtcgcgcagctcgtcgcgcgcgacgcgagcgatggattcatgaac
ttgaactcggtcaaaaacgcgacgagccgcaagtacaagctttcgaaggcgccgaagctc
accgaactcatcgcggcggtgccggtggaacatcgcgatcagttgctgccgaaactcagg
gcgaaaccggtgcgaacggcgagcggggtggcggtggtggcggtgatgagtaaaccgcat
cggtgcccgcacatagcgacgacgggcaacgtgtgcgtgtactgcccgggaggacccgat
agtgattttgagtactccacgcagtcttacactggatatgaaccgacgtcgatgcgagcg
atacgggcgaggtacgatccgtacgcgcagtctcgaggacgggtggaccagttgcgacgg
ctgggacacgcggtggacaaggtggagttcgtgctcatgggagggacgttcatgtcgctg
ccgatcgattatagagattttttcatcagaaatttgcacgattcgctcagtggggcgagc
tcgtcgtgcgtggatgaggctgtgaaggcgtcggagcagagtaggacgaagtgcgtgggg
ttgacgattgagacgcggccggattattgtcagtcaccgcatttgcgacagatgttgtcg
tacgggtgcacgcgattggaaatcggtttgcagagcatctatgaagacgtcgcgcgcgac
accaatcgtgggcacaccgtggcggcggtgcaaaagtgttttgaattagccaaagacgcg
ggatttaaagtcatcgcgcacatgatgccggatttgccaaacgtgggcatggagcgcgat
ttggagtcgtttcgagaatttttcgagtcgcctgattttagaacagatggcttgaagctt
tatcctacgctcgtcattcgaggtacaggattgtacgagttgtggcgcaccggcaagtat
agaaattaccaccccgagcgcttggtggatttagtcgcgcgagtgctcgcgctcgtccca
ccctgggtccgggtctatcgcgtccagcgcgatattcccatgcctctcgtcaccgcgggc
gtggagaagggtaaccttcgtgagctcgcgatggcgcgcatggcggatctaggcttaaga
tgtcgcgacgtgcgcacgcgcgaagtcggcttacaagatattcataaccgcgtcgctccg
acgcacgttgaactcgtccgtcgcgactacgtcgccaatggcgggtgggagacattctta
tcttacgaagatccgcgacaagacatcttggtaggactcttgcgtcttcgcaagtgcggt
cgaacggccgccaagacgtcgcctgcgctcaagggcaaatgttccatggttcgcgagctt
cacgtctacggcaccgccgtcgccgtgcactcgcgacacaagggtcgctttcaacaccgc
gggtatggcactttactcatgcgcgaggccgagcgcatcgctcgcgaagaacacggctcg
agcaagctcgccgtgatttccggcgtcggcacgcgacactactatcgcaagctcggatac
gaattagaagaaacctacatggtgaagcatctctccgcgaacgagtag

DBGET integrated database retrieval system