KEGG   Ostreococcus lucimarinus: OSTLU_28794Help
Entry
OSTLU_28794       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
olu  Ostreococcus lucimarinus
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:olu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    OSTLU_28794
Exosome [BR:olu04147]
 Exosomal proteins
  Proteins found in most exosomes
   OSTLU_28794
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 1688 aa AA seqDB search
MAAPAVPVTVKEAIQLKTCGVNPQCISFTNLTMESEKYVCARESGTTNNVVIVEVNNPLQ
PMKKPITADSALMNPTQNVIALKARVENENGVEDSLQIFNIDQKAKIKGHDMEPVVFWKW
ITPKMLGIVTNTAVFHWSIDDANAPVKVFDRTANLNGNQIISYKASEDMQWFTLIGIAQG
DASRPALVKGNMQLYSVAQQRSQPLEAHMAAFTTHQVPGNAQKSQLVCFAQKMVQADGSV
VSKLHVIELGAPAGQTPFTKRTSELFFPPEFADDFPVVMQVSDKYGVIYIVTKSGLLFVY
DVETASPIYRSRISQDPVFVGASATSVGGLYVVNRGGQVLLITLNEAAVVPFISSTLNNL
ELALSVASRGNLPGADALVMPKFDMLFNSADYKGAAELAASMSSLRTDQTIARFRGVPTQ
PGQSSPLLQYFGACLQRGKLNKLESVELAKLVLAQNKKQLLDTWLSEDKLEASEELGDML
APTDSDTALKIYVKARASPKVTAAFAQRGEFDKMAQYCSAVDYKPDYMYMLQALMMKDPA
SAVQLAQKISQMTPPPCDMGAIADLFLQRNMIREATSILLDLLKGDDESQAALQTKVLEI
NLVTYPNVADAILAQGKLTHYDRPRIAQLCEKAGLYIRAMEHYTELADLKRCVVNTHSID
PQALTEFFGTLSREWALDCLKELLTFNMRQNLQMAVNIAKEYTEQLEIHSVVKMFDKFES
AEGLFYYLGYFVNTCEDKDLVYKFIEAASKTGQIKEVERVTRESDHYDAERVKVFLMEAK
LSDARPLINVCDRYEFVPDLTTYLYNNNMLRYIEGYVQKVNPKQAPKVVGTLLDLECPDD
FIKTLILSVRSLLPVAPLVEEVEKRNRLKILTQFLEHLVNEGSVDPQVHNAMGKMLIDSN
QNPEHFLLTNEYYESAIVGRYCEKRDPYLACVAYKRGNCDAELVDCTNRNSMFKVQARYV
VERMDADLWASVLTEENKYCRQLIDQVVSTALPESKNPEQVSVTVKAFMTAEMPHELIEL
LEKIVLQNSAFSNNPNLQNLLILTAIKADASRVMDYVNRLDSFNGPEVGEIAAGNELYEE
AFAIFKKFDLHVDAMKILLESLEDLDRGIEYARKVDLPEVWVQIGKAQLKVGTPEAVKAA
IKSYIKAQDGSDFVDVIHAARQADMYEDMVPYLLMVRKNKKEARVDTELVYAYAKINDLA
KLEDFLATPNSANQQSVADRCFGEGLYEAARLLYTALSNWGCLASTLLKLRMFQGAVDAA
KKANSPRTWKEVCFTCLEEGENKLAQLAGLNIIIQADELDSVSEYYQANGKFTELIQLME
AGVGVDRAHMGIFTELGILYANHMADKLMEHIRLFSARINIPRLITTCNHVALWPELAYL
YRCYDEYDNACEVMMKHPDAWEHVVFKDVCVKLANADLYYQAIEFYLREHPTEMTNLLGV
LQSRLDHSRVVSLMRKEGKLAMVKEYLLAVQGANLTAVNDAVNELAIEEEDHAALKTSLD
MYDNCDQLSLAVQCESHELIEFRRISSYIYQRNARWQQAIDLSKRDGLLKDAMEIAAKSG
DATIVDELLDYFIDQGNKECFSAALCTCYDLLKPDEVMQKAWLKGLSDWVMPYMIQVMRD
MNGKLEILMKDKADRNEEKVNEEKERVAAEMNSNLYAQLMPAALPAPPMPGMPGYEQPQP
GYGQPQYY
NT seq 5067 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcccgcggtgccggtcacggtgaaagaagcgatacagttgaaaacgtgcgga
gtgaacccgcaatgtatttcgttcacgaatctcaccatggagagcgagaagtacgtgtgc
gctcgggagagcgggacgacgaataatgtggtgatcgtcgaggtgaataacccgctgcag
ccgatgaagaaaccgatcacggcggatagcgcgcttatgaacccgacgcagaacgtgatt
gcgctcaaggcgagagtggagaacgagaatggcgtggaggattcgttgcagattttcaac
attgatcaaaaggcgaaaatcaaggggcacgacatggagccggtggtgttttggaagtgg
atcacgccgaaaatgttggggatcgtgaccaacaccgcggtgtttcactggtcgatcgat
gacgcgaacgcgccggtgaaggtgtttgacagaactgcaaacctgaacgggaatcagatc
atcagctataaagcatcagaggacatgcagtggttcacgctgatcggtatcgcgcaaggc
gacgcgtcgagaccggcgttagtgaagggtaacatgcagctgtactcggtggcgcaacaa
cgctcgcagccgctcgaggcgcacatggcggcgttcacgacgcaccaagtgccgggcaac
gcgcaaaagagtcagttggtatgtttcgctcaaaagatggttcaagccgatggatcggtg
gtttccaagcttcatgtgattgagctcggcgcgccggcagggcaaacgccgttcacgaag
cgcacgagcgagttgtttttcccgcccgagtttgccgacgacttcccggtcgtcatgcaa
gtgagcgacaaatacggcgtcatttacatcgtcaccaagagcggtctgctgttcgtgtac
gacgtggaaactgcgtcgccgatctaccgaagccgcatttcgcaagatccggtcttcgtc
ggcgcgtccgcgacgagcgttggcggtttgtacgttgttaacagaggcggccaagtcttg
ttgatcaccctgaacgaagccgccgttgtgccgttcatcagcagcacgctcaataacttg
gagcttgcgctttcggtcgcgtcgagagggaatcttcccggcgccgatgcgctcgtgatg
cccaagtttgatatgctcttcaactctgcggactacaagggggcggccgaactcgcggcg
agcatgagctcgttgcgcacagatcagaccatcgcccgatttcgcggcgtcccgactcaa
ccgggccaaagttctcctttgttacagtactttggcgcgtgcttgcagcgcggaaagttg
aacaagctggaatcagttgaactcgcaaagctcgtgcttgcgcaaaacaagaagcagctt
ctcgacacatggctgagcgaggacaagctcgaggcgagcgaagaactcggcgacatgctg
gcgccgactgactccgatactgcgcttaagatttacgtcaaagcacgcgcgagtccgaag
gtaaccgcagcgttcgcgcagcgtggcgaattcgacaagatggcgcaatactgctccgcc
gtcgattacaagccagactatatgtacatgttgcaagctcttatgatgaaagatcccgcg
agcgcggtgcagttggcacaaaagatcagtcagatgacaccgccaccgtgcgacatgggg
gccatcgccgatctcttcttgcagcgcaacatgattcgtgaggcgacatcgatcttgctc
gatttgctcaagggcgacgacgagagccaagcggcgctgcaaaccaaggttcttgagatc
aacttggtgacatacccgaacgtcgctgatgcgatcttggcgcaaggaaagctcacgcac
tacgaccgcccgcgcatcgcgcagctctgcgagaaggctggtctttacattcgagccatg
gagcactacacggagctcgccgacttgaagcgttgtgtcgtcaacacacactcgatagac
ccgcaagcgctcactgaattcttcggtacactgagccgcgagtgggctttggactgcctt
aaggaacttctcacgttcaacatgcgtcaaaaccttcagatggcggtgaacattgctaag
gagtacacggaacaactcgagattcactctgtcgtgaagatgtttgacaagtttgaatct
gccgaaggcctcttctactacctcgggtacttcgtgaacacgtgtgaagacaaggacctt
gtgtacaaatttatcgaagctgcttcaaagactggacagatcaaggaagtcgagcgagtg
acgcgcgagagcgatcattacgatgccgaacgcgtcaaggtgttcctcatggaagccaag
ctctcagatgctcgtccgcttatcaatgtgtgcgaccgttatgagttcgttccggatttg
acgacatacctttacaacaacaacatgttgcgctacatcgaaggctacgtgcaaaaagtc
aacccgaagcaggcgccgaaggtcgttggtacactgttggatctcgagtgcccggacgat
ttcatcaagactctcatcttgtccgtgcgatctctcttgcccgtggcgccgctcgtggaa
gaagtggagaaacgtaaccgcttgaagatcctcacgcaattcctcgagcacctcgtgaac
gaagggagcgtggatccgcaagtacacaacgccatgggtaagatgctcatcgatagcaac
cagaacccagagcactttttgctcacaaacgagtactacgagtccgccatcgtcggtcgc
tactgcgagaagcgcgatccgtacttggcgtgcgtagcgtacaagcgtggcaactgcgac
gcagagttggtggattgcacgaacagaaacagtatgttcaaggttcaggcgagatatgtc
gtcgagcgtatggacgccgatctctgggcatctgtgttgacggaagaaaacaaatactgc
cgccagcttatcgaccaagtcgtgtctaccgcactcccagaaagcaagaaccctgagcaa
gtttctgtgaccgtgaaggcgttcatgacggcagaaatgccgcatgaactcatcgagttg
ttggagaagatcgtgctacaaaacagcgcgttcagcaacaacccgaacttgcaaaacttg
ctcatccttaccgccatcaaggcggacgcatctcgcgtcatggattacgtcaaccgactc
gactctttcaacggtccggaggtcggtgagattgccgccggtaacgagttgtacgaagaa
gcctttgccatcttcaagaagtttgatctgcatgttgacgcgatgaagattcttctcgag
tctctcgaagacctcgatcgtggcatcgagtacgcgcgcaaggtcgacttacccgaagtt
tgggtccaaatcggcaaggcgcagctcaaggttggcactccggaggcggttaaagcggcc
atcaagtcgtacatcaaggcgcaagatgggagtgatttcgtcgacgtcattcacgccgcg
cgccaagccgacatgtacgaagacatggttccatatttgctcatggtgcgcaagaacaag
aaagaagctcgcgtcgatactgaacttgtgtacgcgtacgccaagatcaacgatttggcc
aagctcgaagactttttggctacgccgaacagcgcgaatcagcagtccgtcgccgacaga
tgctttggcgaaggtttgtacgaggctgctcgacttttgtacaccgcgctcagcaactgg
ggctgccttgcgagcactttgctcaaacttcgcatgttccaaggtgcagtcgacgccgcg
aagaaggctaactccccgcgtacgtggaaggaagtgtgctttacgtgtctcgaagaaggc
gaaaacaagctcgcgcagctcgccggtctcaacatcattatccaagctgatgaactcgat
tccgtcagtgagtactaccaagcgaatggtaagttcaccgagcttatccagcttatggaa
gccggcgtcggcgttgaccgggcgcacatgggtattttcaccgagctcggcatcttgtac
gccaaccacatggccgacaagctcatggaacacattcgtttgttcagcgcgcgcatcaat
attccgcgactcataaccacgtgcaaccacgtggcgttgtggcccgagctcgcgtatctt
tacaggtgctacgacgagtacgataacgcttgcgaggtgatgatgaagcaccccgacgct
tgggagcacgtggtcttcaaggatgtgtgcgtcaagcttgccaacgcggacttgtactac
caggcgatcgagttttaccttcgcgagcacccaacagagatgaccaatcttctcggtgta
cttcagtcgagacttgatcactctcgcgtggtgtcgctcatgcgcaaggagggtaagttg
gccatggtgaaggagtaccttttagctgtgcagggtgcaaacttgacggcggtgaacgac
gccgtgaacgaactcgcgatcgaagaagaagatcacgcggcgttgaagacttcgctcgat
atgtacgacaattgcgatcaactatctcttgcggtacaatgcgagagccacgaactgatc
gagttccgaagaatttcttcgtacatctatcagcgcaacgcgcgatggcagcaagccatc
gatcttagcaagcgggatgggttacttaaggacgccatggaaatcgccgcgaagagtgga
gacgcgaccatcgtggacgaacttctcgactacttcatcgatcaaggcaacaaggagtgc
ttctccgccgccttgtgcacgtgctacgacttgttgaagcccgacgaagtcatgcaaaag
gcatggttgaagggtcttagcgactgggtcatgccttacatgattcaagtcatgcgtgat
atgaacggtaagttggagattttgatgaaggataaggcggaccgcaacgaagaaaaggtg
aacgaggagaaagagcgcgtcgcggccgagatgaatagcaacctctacgcgcaactcatg
cctgcggcgcttccggctccgccgatgccgggcatgccggggtacgagcaaccgcaaccg
ggatacgggcaaccgcagtattactga

DBGET integrated database retrieval system