KEGG   Ostreococcus lucimarinus: OSTLU_28845Help
Entry
OSTLU_28845       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00860  Porphyrin and chlorophyll metabolism
olu01100  Metabolic pathways
olu01110  Biosynthesis of secondary metabolites
Module
olu_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    OSTLU_28845
Enzymes [BR:olu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     OSTLU_28845
Exosome [BR:olu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OSTLU_28845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-GeneID: 4999430
NCBI-ProteinID: XP_001415482
JGI: 28845
UniProt: A4RR03
Position
1:join(398187..398316,398527..399557)
Genome map
AA seq 386 aa AA seqDB search
MLSTTITTPSAFVKPQAPRTRVKARADSTMAPPTTRVPPRNPEGAPTVVPQDLPSRPRRN
RRSPTVRKAFRETILTPDNFIYPIFVHEGDENIPIGSMPGQDRLSFKNGMIKQVREARAA
GVNQVVVFPKTPDNLKTACGKEAFNPNGLAQRSISLLKDTFPDLEVYTDVALDPYNTMGH
DGMVRSDGVVMNDETVYYLCQQAVSQARAGADVISPSDMMDGRVGAIRQALDDEGFTNVA
IMSYTAKYNSAYYGPFRDALASAPRPGSEDWKIPKDKAEYQMDPANYRECLREAALDEQE
GADIMMVKPAGAYLDIIRALRDSTTLPISAYQVSGEYSMLKAAAAAGYLNERDAVLESLI
AIKRAGADLTLTYYAIDAAKWIQEGN
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgctttcgacgaccatcaccaccccgagcgctttcgtgaagccgcaagcgccgcgaacg
cgcgtcaaggcgcgcgccgacagcaccatggccccgcccacgacgcgcgtgccgccgaga
aaccccgaaggcgcgccgacggtggtgccgcaagatttgccgagccgaccgcgacgcaac
cgccgctcgccgacggtgcgaaaggcgttccgcgagacgattctcacgccggataacttc
atttacccgattttcgtgcacgagggcgatgagaacattcccatcggttctatgccggga
caagaccgcctgagcttcaagaatggcatgatcaagcaagtgcgcgaggcgcgcgcggcc
ggcgtgaaccaagtggtcgtcttcccgaagaccccggataacttgaagacggcttgcggg
aaggaggcgttcaatccgaacggcttagcccaacgctcgatctcgttgttgaaggatacg
ttccccgatttggaagtgtacaccgacgtcgcgctcgatccgtacaacactatgggccac
gacggcatggtgcgctccgacggcgtcgtcatgaacgacgaaacggtgtactatttgtgc
caacaagccgtgtcccaagcgcgcgcgggtgctgatgttatttctccgtccgatatgatg
gatggtcgcgtcggtgccattcgccaagcgctcgacgacgaaggtttcaccaacgtcgcc
atcatgagttacaccgccaagtacaacagcgcgtactacggtccgttccgtgatgccttg
gcgtcggcgccgcgtccgggtagtgaagactggaagattccgaaggacaaggctgagtac
caaatggacccggccaactaccgtgagtgcttgcgcgaagctgctctcgatgaacaagag
ggcgcggacatcatgatggtcaagccggcgggcgcctacttagacatcatccgcgcgctt
agagacagcaccacgctcccaatttccgcgtaccaagtgtctggcgaatactccatgttg
aaggctgccgccgcggcgggttaccttaacgaacgcgatgcggtcttggaatccttgatc
gccatcaagcgcgccggagccgacttgacgttaacgtactatgccatcgatgccgccaag
tggatccaagaaggcaactaa

DBGET integrated database retrieval system