KEGG   Ostreococcus lucimarinus: OSTLU_28845Help
Entry
OSTLU_28845       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
olu  Ostreococcus lucimarinus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:olu00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 386 aa AA seqDB search
MLSTTITTPSAFVKPQAPRTRVKARADSTMAPPTTRVPPRNPEGAPTVVPQDLPSRPRRN
RRSPTVRKAFRETILTPDNFIYPIFVHEGDENIPIGSMPGQDRLSFKNGMIKQVREARAA
GVNQVVVFPKTPDNLKTACGKEAFNPNGLAQRSISLLKDTFPDLEVYTDVALDPYNTMGH
DGMVRSDGVVMNDETVYYLCQQAVSQARAGADVISPSDMMDGRVGAIRQALDDEGFTNVA
IMSYTAKYNSAYYGPFRDALASAPRPGSEDWKIPKDKAEYQMDPANYRECLREAALDEQE
GADIMMVKPAGAYLDIIRALRDSTTLPISAYQVSGEYSMLKAAAAAGYLNERDAVLESLI
AIKRAGADLTLTYYAIDAAKWIQEGN
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgctttcgacgaccatcaccaccccgagcgctttcgtgaagccgcaagcgccgcgaacg
cgcgtcaaggcgcgcgccgacagcaccatggccccgcccacgacgcgcgtgccgccgaga
aaccccgaaggcgcgccgacggtggtgccgcaagatttgccgagccgaccgcgacgcaac
cgccgctcgccgacggtgcgaaaggcgttccgcgagacgattctcacgccggataacttc
atttacccgattttcgtgcacgagggcgatgagaacattcccatcggttctatgccggga
caagaccgcctgagcttcaagaatggcatgatcaagcaagtgcgcgaggcgcgcgcggcc
ggcgtgaaccaagtggtcgtcttcccgaagaccccggataacttgaagacggcttgcggg
aaggaggcgttcaatccgaacggcttagcccaacgctcgatctcgttgttgaaggatacg
ttccccgatttggaagtgtacaccgacgtcgcgctcgatccgtacaacactatgggccac
gacggcatggtgcgctccgacggcgtcgtcatgaacgacgaaacggtgtactatttgtgc
caacaagccgtgtcccaagcgcgcgcgggtgctgatgttatttctccgtccgatatgatg
gatggtcgcgtcggtgccattcgccaagcgctcgacgacgaaggtttcaccaacgtcgcc
atcatgagttacaccgccaagtacaacagcgcgtactacggtccgttccgtgatgccttg
gcgtcggcgccgcgtccgggtagtgaagactggaagattccgaaggacaaggctgagtac
caaatggacccggccaactaccgtgagtgcttgcgcgaagctgctctcgatgaacaagag
ggcgcggacatcatgatggtcaagccggcgggcgcctacttagacatcatccgcgcgctt
agagacagcaccacgctcccaatttccgcgtaccaagtgtctggcgaatactccatgttg
aaggctgccgccgcggcgggttaccttaacgaacgcgatgcggtcttggaatccttgatc
gccatcaagcgcgccggagccgacttgacgttaacgtactatgccatcgatgccgccaag
tggatccaagaaggcaactaa

DBGET integrated database retrieval system