KEGG   Ostreococcus lucimarinus: OSTLU_29493Help
Entry
OSTLU_29493       CDS       T01029                                 

Definition
(RefSeq) hypothetical protein
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
olu  Ostreococcus lucimarinus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OSTLU_29493
   01230 Biosynthesis of amino acids
    OSTLU_29493
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OSTLU_29493
   00030 Pentose phosphate pathway
    OSTLU_29493
   00051 Fructose and mannose metabolism
    OSTLU_29493
   00052 Galactose metabolism
    OSTLU_29493
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    OSTLU_29493
Enzymes [BR:olu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     OSTLU_29493
Protein phosphatases and associated proteins [BR:olu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     OSTLU_29493
Messenger RNA biogenesis [BR:olu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     OSTLU_29493
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
20
AA seq 416 aa AA seqDB search
MRKTNFVSNSDRILLNSVAYGSAADPTQTCSLSSDVYDPSGCDYVPEWVVRAGPRAEVYF
DPEEVHAAVVTCGGLCPGINDVIRSLVNTLEVGYGVKKISGVRYGFKGFFSGDEFMPLNR
KVVRNIHNIGGSALGSGRGGGDVEKIVESIVNNGINMVFVIGGNGTHAGANAISNECAKR
GVKVSVVGVPKTIDNDILLLDKTFGFDTAVEEAQKAIQAAAIEAQSAYRGVGVVKLMGRQ
SGFIAMFATLANGQVDCCLIPEISWAAHGPNGVVEYVRNMLDAQGHAVVVLAEGAGQEFV
SAGGTDAGGNPKLGDIGQWFCKQLKAEIKCDVKYIDPTYMVRGCVANAHDSIMCTVLGQN
AVHGAFAGFTGISVGSVSAHTAFLPIPRMIERERLVDPDGRMWHRTLASTGQPDFF
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagactaactttgtgagcaatagtgatcggatattgctgaactcggtggcgtac
gggagcgcggcggatccgacgcagacgtgctcgttgtcgagcgacgtgtacgacccgagc
gggtgcgattacgtgccggagtgggtcgtccgggcgggaccgagggcggaggtttatttc
gatccagaggaagtgcacgcggcggtggtgacgtgcggaggattgtgcccgggaatcaat
gacgtcattcgatcgctcgtgaacaccctggaggttggctacggggtgaagaagattagc
ggcgtgcgatacggatttaaagggttcttctccggcgacgaattcatgccgttgaacagg
aaggtggtgagaaacattcacaacatcggtgggtctgcgcttggatccggcagaggcggt
ggagacgtggagaaaatcgtggaatctatcgtaaataacggaatcaacatggttttcgtc
atcggcggcaacggcacgcacgccggggcaaacgcgataagtaatgaatgcgccaagcga
ggggtcaaggtctccgtagtgggcgtcccgaagacgatagataacgatatccttcttctg
gataagacttttgggttcgacaccgcggtcgaagaggcacagaaagcgattcaagccgcg
gccattgaggcgcagagcgcctatcgcggcgtcggcgtggtgaagctcatgggacgtcag
agcggatttatagccatgttcgcgacgctggcgaacggacaagtcgattgctgtttgatt
cccgagattagctgggcggcacacggcccgaatggcgtggtcgagtacgttcgaaacatg
ttggacgctcaaggtcacgccgtcgtcgtcctcgccgagggcgccggccaagagttcgtc
tccgccggcggcaccgacgccggcggtaaccccaagctcggtgacatcggtcaatggttt
tgcaagcaactcaaagccgagatcaagtgcgacgtcaagtacatcgatcccacgtacatg
gttcgcggttgcgtcgccaacgcccacgattccatcatgtgcaccgtcctcggccaaaac
gccgtccacggcgccttcgccggtttcaccggcatctccgtcggctccgtcagcgcgcac
accgcgtttttaccgatccctcgcatgatcgagcgcgagcgtttggtcgatcccgacggt
cgcatgtggcaccgcaccctggccagcaccgggcagccagacttcttctga

DBGET integrated database retrieval system