KEGG   Ostreococcus lucimarinus: OSTLU_30748Help
Entry
OSTLU_30748       CDS       T01029                                 

Gene name
HAG3502
Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
olu  Ostreococcus lucimarinus
Brite
Enzymes [BR:olu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     OSTLU_30748 (HAG3502)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 494 aa AA seqDB search
MDDDQAAKRAKLAARFGDENADLGFAMPATVSASAQGLSTQTTTIDLNSKSNSCGAKIAK
KPIDAPVSYVCEAVDALKFHPWTPGSALETTRDDGDAFDAEFTHQVFREDESVFGYAGLA
LDVYVCRTSLRALLKMRYEKKISSAMNPADPVVEQMREWFDSDGLCELYEDEERFKREAG
MAEPCAGGTLVAESESDGVVTKITAYELATNEEARKWHAAMEAYAVFFIDAASKIDNSDS
RWTLLVATRHHADGRWETAGFTTVYRFYAYPDSERARLSQILVLPPYQRQGLGGKMLEAV
RKLAIDRSMRDLTIEDPTDQLQRLRDVHDVKACLKLPEMMAKVQSAAMDAARAQTDDARR
NALACTQHVFEMAAAKLKICKPQMRRIWEALLFIFAKRSNAPENSPVADAFKELIIRRLK
AMYTSNSDKDIGTKRIIPIGDNDFVMTKARGSAGEAPQMENPADGEADITEVLGELFQEC
AQNLSFIFAQCKDA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgatcaggcggcaaagcgcgcgaaactcgcggcgaggttcggcgatgaaaac
gccgatctcggtttcgcgatgccggcgacggtaagcgcgagcgcgcaggggctgtcgacg
cagacgacgacgatcgatttgaattcgaaatccaacagctgcggcgcgaaaatcgcgaag
aaaccgatcgatgcgccggtgtcgtacgtgtgcgaggccgtggatgcgttgaagtttcat
ccctggacgcctggaagcgcgttggagacgacgagggacgatggtgatgcgttcgacgcg
gagtttacgcatcaggtgtttcgcgaagatgagagcgtgttcggatacgcggggttggcg
ttggacgtgtacgtgtgcaggacatcgttgcgagcgctgttgaagatgagatacgaaaag
aaaatatcgagcgcgatgaatccggcggatcccgtggtggagcaaatgcgagagtggttt
gattcagatggattgtgcgagctgtacgaggatgaggagagatttaaacgcgaggcgggt
atggcagaaccatgcgctggtggcacgctggtggcagagagtgagagcgatggggtggtg
acaaaaatcactgcgtacgagttggcgacgaatgaggaggcgagaaagtggcacgccgcg
atggaggcgtacgcggtgtttttcatcgacgcggcgagcaagattgataactcagactcg
cgttggactctgctcgtggcgacgaggcatcacgccgatggacgctgggaaaccgctgga
tttacgacggtatatcggttctacgcctatcctgattccgagcgagcgcgattgagccag
attttggtgctccctccgtaccagcgacaaggcctcggtgggaagatgttggaagccgtt
cgcaagctcgcgattgatcgatcgatgcgagatttgacgattgaagaccccacagatcag
ttgcaacgattacgagacgtgcatgacgtcaaggcttgcttgaaactaccggagatgatg
gccaaggttcaaagtgcggcgatggacgccgcgcgagcgcagaccgacgacgctcgacgc
aacgcattggcctgcacgcagcacgttttcgaaatggctgccgcgaagctgaaaatttgc
aagcctcaaatgcgtcgtatctgggaagctttgctcttcatcttcgccaagcgttcaaat
gccccggagaatagccccgtggcggatgcgttcaaggaactcatcattcgtcggctcaag
gcgatgtatacgtcgaattccgacaaagatataggcaccaagcgcatcatcccgatcggt
gataacgatttcgtcatgaccaaagcgcgaggttccgccggtgaggcgccgcagatggaa
aatcccgcagatggtgaggctgacatcaccgaagttttaggcgaactctttcaagagtgc
gcgcaaaatttgagtttcatctttgcgcagtgcaaagacgcgtga

DBGET integrated database retrieval system