KEGG   Ostreococcus lucimarinus: OSTLU_31255Help
Entry
OSTLU_31255       CDS       T01029                                 

Gene name
DXR
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplast precursor (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
olu  Ostreococcus lucimarinus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OSTLU_31255 (DXR)
Enzymes [BR:olu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     OSTLU_31255 (DXR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 465 aa AA seqDB search
MTTATTATTKATARDARRETRARRAIATRASNNENRYGACWPGRAEVPANVAALGNGNVK
KISLLGSTGSIGTQTLDICEEHPDKFEVVALSAGRNVTLVAEQCAKFSPKLVSVQNGEDV
AKLRDALQKLGCAMPEIMYGEDGMVEVARHADCDSVVTGIVGCAGLPPTVAAIEAGKNIC
LANKETLIAGGPAIVPLAVKHGVKILPADSEHSALFQCIQGMPEGALRRIILTASGGAFR
DMDLATMRELAVSDPAALHKKATTHPNWDMGAKITCDSATLMNKALEVIEAHYLYGTSYD
NIDVIVHPQSIVHSMVETSDSSVLAQLGWPDMRLPILYTMSWPNRVECSEVTWPRLDFVK
MGDLTFRAPDFEKYPSLTMGYAAGRAGGTMTGVFSAANEQAVAMFLDKKMGYFDIYKVIE
LAMEAHKNELVLDPSLDDIVHYDLWARDHVKQTVESGVLTGALPR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgacgacggcgacgacggcgacgacgaaagcgacggcgcgggacgcgcgacgcgagacg
cgcgcgcgacgcgcgatcgcgacgagggcgagcaacaacgaaaaccgctacggcgcgtgc
tggccgggacgcgcggaggtgccggcgaacgtcgcggcgctcgggaacggaaacgtgaag
aagatatcgctgctcggaagcacggggtcgatcgggacgcagacgctggacatttgcgag
gaacatccggataagtttgaggtcgtggcgctgagcgcggggcgaaacgtgacgctggtg
gcggagcagtgcgcgaagttctcgccgaagttggtgagcgtgcagaacggagaggacgtg
gcgaaactgagggatgcgttgcaaaaactcggatgcgcgatgccggagattatgtatggg
gaggatgggatggttgaggtggcgagacacgccgactgcgattcggtggtgacgggcatc
gtcggatgcgcgggattgccgccgacggtggcggcgatcgaggcgggaaagaatatttgc
ttggcgaataaggagaccctcatcgccggtggccccgcgatcgtgccgttggcggtgaag
catggggtgaaaattttgcccgcggattccgagcacagcgccttgttccagtgcattcaa
ggcatgccggagggcgcgctgagacgcatcattctcaccgcctctggcggcgctttccgc
gatatggacctcgccaccatgcgtgaactcgcggtgtccgatcccgcggcgttgcacaag
aaggcgacgacgcacccgaactgggacatgggcgcgaagattacgtgcgacagcgcgacg
ctcatgaacaaggcgctcgaagtcatcgaggcgcactacctctacggcacctcttacgac
aacattgacgtgatcgtgcacccgcaatcgatcgtgcactccatggttgagacctcggat
agctccgttttggcgcaattgggctggcctgacatgcgtttgcctattctttacaccatg
tcttggcccaaccgcgtcgagtgctccgaagtcacgtggccgcgactcgactttgtcaag
atgggcgacctcaccttccgcgcgcccgatttcgaaaagtacccgtctctcaccatgggc
tacgccgccggtcgcgccggtggcaccatgacgggcgttttctccgccgccaacgagcaa
gcggtcgccatgttcttggacaaaaagatgggctacttcgacatttacaaagtcatcgag
ttggccatggaggcgcacaagaacgagctcgtgctcgatccgtccctggacgacatcgtg
cactacgatttgtgggcgcgcgatcacgtcaagcaaaccgtggaatctggcgttttgacc
ggcgccctgcctcgttaa

DBGET integrated database retrieval system