KEGG   Ostreococcus lucimarinus: OSTLU_31320Help
Entry
OSTLU_31320       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
olu  Ostreococcus lucimarinus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:olu00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 751 aa AA seqDB search
MPRPPALATTTTTREGRATRDATRTNAVDSAKSVDVDATTTRDGAEAIARDEGLRGHEEH
LKYRYATYRARREAIESAEGSLDAFSKSYEKYGFNADEKSGEITYREWAPAAAHCALIGD
FNGWNGEATAMTRDEYGTWEVKLPKGAIEHGSRVKVRIFTGDGAQIDRVPAWVRRATVEE
GVMGAGYDGVYWAPEEKYEFKHAAPKKPQASRIYEAHVGMSSNDAKVNSYREFADDVLPR
IAAGGYNTVQLMAVMEHAYYGSFGYHVTSPFAVSSRSGTPEDLKYLVDKAHGLGVRVLLD
IVHSHASSNVNDGIAGFDFGQRAEDSYFGQGEAGYHWLWDSRLYKYDNWEVLRYLLSNLR
YWVDEYKLDGFRFDGVTSMLYHHHGLQMEFSGDYEQYFSTATNVDGVVYLMLANEMLHSL
YPEIEVIAEDVSGMPTLCLPVNEGGVGFDARLAMSIPDFWVKYLKERPDEQWSMFEMVST
LCNRRYTEKAIAYVESHDQSIVGDKTTAFWLMDAEMYSGMSTLNEPSIVIQRGIALHKMM
RLVTASLGGEGYLTFMGNEFGHPEWVDFPREGNNWSHDYCRRRWDLADADHLRYQHLLKF
DKAMLALDNDYPYMGAAHQHVSTADDGRQILVFERGDLLFVFNFHPTNTYEGLEIGVPEQ
GKYRLALDTDAGEFGGASRCGFGVDHFTSPEPVESWVGPYEQTPRAAKMFVLSPSRSAQV
YYRVHEHTPVSSEPSTEDIVRENDASASNAR
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgaccgccagcgctggcgacgacgacgacgacgcgcgagggacgcgcgacgcgc
gacgcgacgcggacgaacgcggtcgacagcgcgaagagcgtcgacgtcgacgcgacgacg
acgcgggacggcgcggaggcgatcgcgcgggacgagggactgcgaggacacgaggaacac
ttgaagtatcggtacgcgacgtatcgagcgcggcgagaggcgatcgaaagcgcggaggga
tcgctggatgcgttttcgaaatcgtacgaaaagtacgggtttaacgcggatgaaaagagc
ggggagatcacgtaccgggagtgggcgccggcggcggcgcactgcgcgttgatcggggac
tttaacgggtggaacggcgaggcgacggcgatgacgcgggacgagtacggaacgtgggag
gtgaagctgccgaagggagcgatcgagcacggatctcgggtgaaggtgaggatttttacc
ggggatggcgcgcagatcgatcgcgtgccggcgtgggtgcgccgggcgacggtcgaggag
ggagtgatgggcgccggatacgacggcgtctactgggcgcccgaggaaaagtacgagttc
aaacacgcggcgccgaaaaagccgcaggcgtcgcgaatttacgaagcgcacgttgggatg
agctcgaacgatgccaaggtgaactcttaccgcgagttcgccgatgatgttttgccgaga
atcgccgccggtgggtacaacaccgtgcaactcatggcggtgatggagcacgcgtactac
ggatccttcggctaccacgtcacgagtccgttcgcggtgtcgtcgcgaagcgggacgcct
gaagacttgaagtacttggtcgacaaggcgcacggcttgggcgtgcgcgtgttgctcgat
atcgtgcactcgcacgcgtcgagcaacgtcaatgacggcatcgccggatttgatttcgga
caacgcgccgaggattcgtacttcggtcaaggcgaggctggctatcactggttgtgggac
tctcgcctgtacaagtacgacaactgggaagtgttgcggtatttgctctcgaacttacgc
tactgggtcgacgagtacaaattggacggcttccgattcgacggcgtcacgtcgatgctg
taccatcaccacggattacaaatggaattttccggtgattacgaacaatacttttctacc
gccacgaacgtcgacggtgttgtgtacttgatgctcgcgaacgagatgcttcactcgttg
taccctgaaattgaagtcatcgcggaggacgtgagcggcatgcccacgttgtgcttgccc
gtcaacgaaggcggcgtcggtttcgacgctcgtttggccatgtccatccccgacttttgg
gtgaagtatctgaaagaacgccccgatgagcaatggagcatgttcgaaatggtgagcacg
ctgtgcaaccgccgttacaccgagaaggccatcgcgtacgtcgagtcgcacgatcaatcc
atcgtcggcgacaagacgacggcgttttggttgatggatgcggaaatgtactctggtatg
tccactttgaacgaaccatccatcgtgatccaacgcggcatcgcgcttcacaagatgatg
cgtctcgtcaccgcttctctcggcggtgagggctaccttaccttcatgggcaacgagttc
gggcatcccgagtgggtggatttcccgcgcgaaggcaacaactggagccacgactactgc
cgccgacgctgggacttggccgacgccgaccacttgcgttaccaacaccttctcaagttc
gacaaagccatgctcgcgctggacaacgattacccgtacatgggtgccgcccaccaacac
gtgagcaccgccgacgacggtcgccagatcctcgtcttcgagcgcggcgacctcctcttc
gtcttcaacttccatcccacgaacacgtacgaagggctcgagatcggcgtccccgagcaa
ggcaaataccgtctcgctctcgataccgacgccggtgaattcggcggcgcctcccgatgc
ggtttcggcgtcgatcacttcacctcgcccgagcccgtcgagagctgggtcggcccgtac
gagcaaacgcctcgcgcggcgaagatgttcgtcttatcgcccagtcgcagcgctcaggtg
tactaccgcgtgcacgagcacacgcccgtatcttccgagccatcgaccgaggatatcgtg
cgcgagaacgacgcctccgcctccaacgcgcgttag

DBGET integrated database retrieval system